KEGG   Chlorocebus sabaeus (green monkey): 103228492
Entry
103228492         CDS       T04361                                 

Gene name
RIOX2, MINA
Definition
(RefSeq) ribosomal oxygenase 2
  KO
K21760  bifunctional lysine-specific demethylase and histidyl-hydroxylase MINA [EC:1.14.11.-]
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:csab03009]
    103228492 (RIOX2)
   03036 Chromosome and associated proteins [BR:csab03036]
    103228492 (RIOX2)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     103228492 (RIOX2)
Ribosome biogenesis [BR:csab03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    103228492 (RIOX2)
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    103228492 (RIOX2)
SSDB
Motif
Pfam: Cupin_4 Cupin_8 Cupin_2
Other DBs
NCBI-GeneID: 103228492
NCBI-ProteinID: XP_007984307
Ensembl: ENSCSAG00000005980
UniProt: A0A0D9R0Z8
Position
22
AA seq 465 aa
MPKKAKPAGSGKEEGPVPCKQMKVEAAGRPSALNFDSPSSLFESLISPIKTETFFKEFWE
QKPLLIQRDDPALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAH
FLQLRKDFDQKRATIQFHQPQRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHY
DDVEVFILQLEGEKHWRLYHPTVPLAREYSVEAEERIGRPVHEFMLKPGDLLYFPRGTIH
QADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTAKEDVELRAGIPRQLLLQVES
TTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAELSTPGGKLPRL
DSVVRLQFKDHIVLTVLPDQDQSDEAQEKMVYIYHSLKNRRETHMMGNEEETESHGLRFP
LSHLDALKQIWNSSTISVKDLKLTTDDERESLVLSLWTECLIQVV
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgccaaagaaagcaaagcctgcagggagtgggaaggaagagggcccggttccctgtaag
cagatgaaggtagaagcagctgggcggccttcagctttaaactttgacagtcccagtagt
ctctttgaaagtttaatctcgcccatcaagacagagacttttttcaaggaattctgggag
cagaagccccttctcattcagagagatgaccccgcactggccacatactatgggtccctg
ttcaagctaacagatctgaagagtctgtgcagccggggaatgtactatggaagagacgtg
aatgtctgccggtgtgtcaatgggaagaagaaggttttaaataaagatggcaaagcacac
tttcttcagctgagaaaagattttgatcagaaaagggcaacgattcagtttcaccaacct
cagagatttaaggatgagctttggaggatccaggagaagctggaatgttactttggctcc
ttggttggctcgaatgtgtacataactcccgcaggatctcagggcctaccgccccattat
gatgatgtcgaggttttcatcctgcagctggagggagagaaacactggcgcctctaccac
cccactgtgcccctggcacgggaatacagcgtggaggccgaggaaaggatcggcaggccg
gtgcatgagttcatgctgaagccgggggatttgttgtactttcccagaggaaccattcat
caagcggatactcctgcggggctggcccactcgactcacgtgaccatcagcacctaccag
aacaattcatggggagatttccttttggataccatctcggggcttgtatttgatactgca
aaggaagacgtggaattacgggccggcataccccggcagctgctcctgcaggtggaatcc
acaactgttgcaacaagacgattaagtggcttcctgagaacgcttgcggaccggctggag
ggcaccaaagaactgctttcctcagacatgaagaaggattttattatgcacagactcccc
ccttactctgcgggagatggggcagagctgtcaacaccaggtggaaagttaccaaggttg
gacagtgtagtgagactgcagtttaaagaccacattgtcctcacagtactgccagatcag
gatcaatctgatgaagctcaagaaaagatggtgtacatctatcattccttaaagaatagg
agagagacacacatgatggggaatgaggaggaaacagagtctcatggacttcgctttcct
ttgtcacatttggatgcactgaagcaaatttggaacagttccactatttctgtcaaggac
ctgaaacttactacagacgacgaaagggaaagcctggtattatccctctggacagaatgt
ttgattcaagtagtctag

DBGET integrated database retrieval system