KEGG   Chlorocebus sabaeus (green monkey): 103232535
Entry
103232535         CDS       T04361                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04080  Neuroactive ligand-receptor interaction
csab04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103232535 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103232535 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 103232535
NCBI-ProteinID: XP_007990844
Ensembl: ENSCSAG00000008386
UniProt: A0A0D9R7Q2
Position
X
AA seq 77 aa
MNLRLCVQALLLLWLSLTAVCGGPLMQLPYGNGLEEGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctccttgaccgcggtg
tgtggagggcccctgatgcagcttccctatgggaatgggctggaagagggcaatgtccgc
cacctggtgcagcccagagggtcgaggaacgggccagggccctggcagggaggtcgaagg
aaattccgccgccagcggccccgcctctcccataagggacccatgcctttctga

DBGET integrated database retrieval system