KEGG   Chlorocebus sabaeus (green monkey): 103239684
Entry
103239684         CDS       T04361                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:csab01002]
    103239684 (ADAMTS13)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     103239684 (ADAMTS13)
Peptidases and inhibitors [BR:csab01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   103239684 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 TSP1_spondin TSP1_CCN Reprolysin_5 Peptidase_M10 Reprolysin_2
Other DBs
NCBI-GeneID: 103239684
NCBI-ProteinID: XP_008003964
Ensembl: ENSCSAG00000015360
Position
12
AA seq 1510 aa
MPQRARSSSRKCSSLRNRLETRPPPLVPRSLGGSPAPDLGRRLSQRLPGSSTSSLIGQAE
DLPKIRDGDERCGRHKGTVEWALLRMRQHHPRARCPSLCVAGILACGFLLGCWGPSHFQQ
SFLQALEPQAVSSYLSSGAPLKGHPPSPSFQRQRQRRAAGSILHLELLVAVGPDVFQAHQ
EDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGW
SRTINPEDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFD
LGVTIAHEIGHSFGLEHDGAPGSGCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAG
RARCVWDPPRPQPGSAGRQPEAQPGLYYSANEQCRVAFGPKAVACTFAREHLDMCQALSC
HTDPLDQSSCSRLLIPLLDGTECGVEKWCSKGRCRSLVELTPIAAVHGHWSSWGPQSPCS
RSCGGGVVTRKRQCNNPRPAFGGRACVGADLQAEMCNTQACEKTQLEFMSEQCARTDGQP
LHSSPGGASFYHWGAAVPHSQGDALCRHMCRAIGESFIMKRGDSFLDGTRCVPSGPREDG
TLSLCVLGSCRTFGCDGRMDSQQVRDVCQVCGGDNSTCSPRNGSFTTGRAREYVTFLTVT
PNLTSVYIANHRPLFTHLAVRIGGRYVVAGKTSISPNTTYPSLLEDGRVEYRVALTEDRL
PRLEEIRIWGPLQEDAEIQVYRRYGEEYGNLTCPDITFTYFQPKLRQAWVWAAVRGPCSV
SCGAGLRWVNYSCLDQARKELVETARCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSVS
CGGGLRERPVHCVEAQGSLLKMLPPARCRAGAQQPAVAVEICNPQPCPARWEVSEPSPCT
SASGAGPALQNETRVQGADGLEAPATEGPDSVDEKLPAPEPCVRMSCPPGWGHLDATSAG
EEAPSPWGSIRTGAQAAHVWTPLAGPCSVSCGRGLMELRFLCMDSALRVPVQEELCGLAS
KPGSQQEVCQAVPCPARWQYKLAACSVSCGEGVMRRILYCARAHGEDDEEEILLDTQCQG
LPRPDPQEACSLEPCPPRWKVTSLGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACAA
LVRPQASVPCLIADCTYRWYVGTWTECSVSCGDGIQRRHDTCLGPQAQAPVPADFCQHLP
KPVTVRGCWAGPCVGQGTPNLVPHEEATAPGQTTATPAGASLEWSQAPALLFSPAPQPRQ
LLPGPQESSAQSSACGRQHLEPTGTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCS
AGDMLLLWGRLTWRKMCRKLLGMTFSSKTNTLVVRQRCRQPGAGVLLQYGSQLAPETFYR
ECDMQLFGPWGEIVSPSLSPATSKAGGCRLFINVAPHARIAIHALATDMDNGTKGANASY
ISIRDIHSLRTTTFHGQQVLYWESESSQAEMEFSEDFLKAQASLRGQYWTLQSWVPEGQD
PQSWKGKEGT
NT seq 4533 nt   +upstreamnt  +downstreamnt
atgcctcagcgcgcacgctccagttcccggaagtgctcgtctctccgcaaccggctggaa
acccggcccccgcccctggttccgcgcagcctgggcggttcgcccgcaccggacttgggc
cgccgtcttagccagcggcttccggggtcatcgacctcgagtttgattggccaagccgag
gacctccccaagatccgggatggggatgagcgatgcggacgccacaagggaactgtggag
tgggctctcctgaggatgcgccagcatcacccccgggcaagatgcccttccctctgcgtg
gccggaatccttgcctgtggctttctcctgggctgctggggaccttcccatttccagcag
agttttcttcaggcattggaaccacaggctgtgtcttcttacttgagctctggtgctccc
ttaaaaggccaccctccttcccccagcttccagaggcagaggcagaggcgggctgcaggc
agcatcctacacctggagctgctggtggccgtgggccccgatgtcttccaggctcaccag
gaggacacggaacgctacgtgctcaccaacctcaacatcggggcagaactgcttcgggac
ccgtccctgggggctcagtttcgggtgcacctggtgaagatggtcattctgacagagccc
gagggtgctccaaatatcacagccaaccttacctcgtccctgctgagcgtctgtgggtgg
agccggaccatcaaccccgaggacgacacggatcctggccacgctgacctggtcctctat
atcacgaggtttgacctggagttgcctgatggtaaccggcaggtgcggggagtcacccag
ctgggtggtgcctgctccccaacctggagctgcctcattaccgaggacactggcttcgac
ctgggagtcaccatcgcccatgagatcgggcacagcttcggcctggagcacgacggcgcg
cccggcagcggctgcggccccagcggacacgtgatggcttcagacggcgccgcgccccgc
gctggcctcgcctggtccccctgcagccgccggcagctgctgagcctgctcagcgcagga
cgggcgcgctgcgtgtgggaccccccgcggcctcagcctgggtccgctgggcgccagcca
gaggcgcagcctggcctctactacagcgccaacgagcagtgccgcgtggccttcggcccc
aaggcagtcgcctgcaccttcgccagggagcacctggatatgtgccaggccctctcctgc
cacacagacccactggaccaaagcagctgcagccgcctcctcattcctctcctggatggg
acagaatgtggcgtggagaagtggtgttccaagggtcgctgccgctccctggtggagctg
acccccatagcagcagtgcatgggcactggtctagctggggtccccaaagtccttgctcc
cgctcctgcggaggaggtgtggtcaccaggaagcggcagtgcaacaaccccagacctgcc
tttggggggcgtgcgtgtgttggtgctgacctccaggccgagatgtgcaacactcaggcc
tgtgagaagacccagctggagttcatgtcggagcagtgcgccaggaccgacggccagccg
ctgcactcctcgcctggcggtgcctccttctaccactggggtgctgctgtaccacacagc
caaggggatgctctgtgcaggcacatgtgccgggcaattggcgaaagcttcatcatgaag
cgtggagacagcttcctggatgggacccggtgtgtgccaagtggcccccgggaggacggg
accctaagcctgtgcgtgttgggcagctgcaggacatttggctgtgatggcaggatggac
tcccagcaggtacgggacgtgtgccaggtgtgtggtggggacaacagcacgtgcagccca
cggaacggctctttcacaactggaagagcgagagaatatgtcacatttctgacggttacc
cccaacctgaccagtgtctacattgccaaccacaggcctctcttcacacacttggcggtg
aggatcggagggcgctacgtcgtggctgggaagacgagcatctcccctaacaccacctac
ccctccctcctggaggatggccgtgtcgagtacagagtggccctcaccgaggaccggctg
ccccgcctggaggagatccgcatctggggacccctccaggaagatgctgagatccaggtt
tacaggcggtacggcgaggagtatggcaacctcacctgcccagacatcaccttcacctac
ttccagcctaagctgcggcaggcctgggtgtgggccgctgtgcgtgggccctgctcggtg
agctgtggggcagggctgcgctgggtaaactacagctgcctggaccaggccaggaaggag
ttggtggagactgcccggtgccaagggagccagcagccaccagcgtggccagaggcctgc
gtgctcgaaccttgcccaccgtactgggcagtgggagacttcggcccatgcagtgtctcc
tgtgggggcggcctgcgggagcggccagtgcactgtgtggaggcccagggcagcctcctg
aagatgttgcccccagcccggtgcagagcaggggcccagcagccagctgtggcagtggaa
atctgcaacccccagccctgccccgccaggtgggaggtgtcagagcccagcccatgcacg
tcagccagtggagcaggcccggccttgcagaacgagacccgtgtgcagggggcagatggc
ctggaggctccagcgactgaagggcctgactccgtagatgagaagctgcctgcccctgag
ccctgtgtcaggatgtcatgccctccaggctggggccatctggatgccacctctgcaggg
gaggaggcaccctccccatggggcagcatcaggacgggggctcaagctgcacacgtgtgg
acccctctggcagggccgtgctccgtctcctgtgggcgaggcctgatggagctgcgtttc
ctgtgcatggactctgccctcagggtgcctgtccaggaggagctgtgtggcctggcaagc
aagcctggaagccagcaggaggtctgccaggctgtcccgtgccctgctcggtggcagtac
aagctggcggcctgcagcgtgagctgtggggaaggggtcatgcggaggatcctgtattgt
gcccgggcccatggggaggatgatgaggaggagatcctgttggacacccaatgccagggg
ctgcctcgcccagacccccaggaggcctgcagcctggagccctgcccacctaggtggaaa
gtcacgtcccttggcccatgttcggccagctgtggccttggcactgctaggcgctcggtg
gcctgtgtgcagctcgaccaaggccaggacgtggaggtggacgaggcggcctgtgcggca
ctggtgcggccccaggccagcgtcccctgtctcattgctgactgcacctaccgctggtat
gtcggcacctggacggagtgctctgtttcctgtggggatggcatccagcgccggcatgac
acctgcctcggaccccaggcccaggcgcctgtgccggctgatttctgccagcacttgccc
aagccagtgactgtgcgtggctgctgggctgggccctgcgtgggacaggggacgcccaac
ctggtgcctcacgaagaagccactgctccaggacagaccacagccacccctgctggtgcc
tccctggagtggtcccaggccccagccctgctcttctccccggctccccagcctcggcag
ctcctgcccgggccccaggaaagctcggcacagtccagtgcctgtggcaggcagcacctt
gagccaacaggaaccattgacatgcgaggaccagggcaggcagactgtgcagtggccatt
gggcggcccctcggggaggtggtgaccctccgcgtccttgagagttctctcaactgcagt
gcgggggacatgttgttgctttggggccggctcacctggaggaagatgtgcaggaagcta
ttgggcatgactttcagctccaagaccaacacgctggtggtgaggcagcgctgcaggcag
ccgggagctggggtgctactgcagtatgggagccagcttgctcctgaaaccttctacaga
gaatgtgacatgcagctctttgggccctggggtgaaatcgtgagcccctcgctgagtcca
gccacgagtaaggcagggggctgccggctcttcattaatgtggctccgcacgcccggatt
gccatccatgccctggccaccgacatggacaatgggaccaagggagccaatgccagctac
atctcgatccgggacatccacagcttgaggaccacaacgttccatgggcagcaggtgctc
tactgggagtcagagagcagccaggctgagatggagttcagcgaggacttccttaaggct
caggccagcctgcggggccagtactggaccctccaatcatgggtaccggaggggcaggac
cctcagtcctggaagggaaaggaagggacctga

DBGET integrated database retrieval system