KEGG   Camelina sativa (false flax): 104760182Help
Entry
104760182         CDS       T05044                                 

Definition
(RefSeq) farnesyl pyrophosphate synthase 1, mitochondrial
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00900  Terpenoid backbone biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Module
csat_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    104760182
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:csat01006]
    104760182
Enzymes [BR:csat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     104760182
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     104760182
Prenyltransferases [BR:csat01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   104760182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt T4SS_CagC
Motif
Other DBs
NCBI-GeneID: 104760182
NCBI-ProteinID: XP_010481370
Position
18
AA seq 388 aa AA seqDB search
MSVSWSSCCRNLGKTIKALHLHLHLRPRGSSLYRRHIQSSSPSSYSMADLKSTFLNVYSV
LKSDLLNDPAFEFTDESRLWVERMLDYNVRGGKLNRGLSVVDSFKLLKEGKDLTEQEVFL
SSALGWCIEWLQAYFLVLDDIMDNSVTRRGQPCWFRVPQVGMVAINDGILLRNHIHRILK
KHFRDKPYYVDLVDLFNEVELQTACGQMIDLITTFEGEKDLSKYSLSIHRRIVQYKTAYY
SFYLPVACALLMAGENLEKHVDVKNVLVDMGIYFQVQDDYLDCFADPETLGKIGTDIEDF
KCSWLVVKALERCSEEQTKTLYENYGKPDPSNVAKVKDLYKELDLEGVFMEYESKSYEKL
TGVIEAHESKAIQAVLKSFLAKIYKRQK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgagttggagtagttgttgtaggaatctggggaagacaataaaggctcttcat
ttacatttgcatctgaggcctcgtgggagcagtctctatcgtcgtcatatccaaagctct
tctccttcttcttattcaatggccgatctcaagtcaacgtttctcaacgtttattccgtt
ctcaagtccgacctccttaatgaccctgccttcgaattcaccgatgaatctcgtctctgg
gttgaacggatgctggactacaatgtacgtggagggaaactcaatcgtggtctctccgtt
gttgacagcttcaaacttctgaaggaaggcaaagatttgactgagcaagaggttttcctc
tcgtctgctctcggttggtgcatcgaatggcttcaagcttatttccttgtgcttgatgac
attatggataactctgtcacccgccgtggtcaaccttgctggttcagagtcccacaggtt
ggtatggttgccatcaacgatgggattctacttcgcaatcacatccacaggattctcaaa
aagcacttccgggacaagccttactatgttgacctcgttgatttgtttaatgaggttgag
ttgcaaacagcttgtggccagatgatagatttgatcaccacctttgaaggcgaaaaggat
ttgtccaagtactcattgtcaatccaccggcgtattgtccagtacaaaacggcttattac
tcattttatctccctgttgcttgtgcactgcttatggcgggtgaaaatttggaaaagcat
gttgatgtgaagaatgttcttgttgacatgggaatctactttcaagtgcaggatgattat
ctggattgtttcgctgatccggagacgcttggcaagataggaacagatatagaagatttc
aaatgctcgtggttggtggttaaggcattggaacgctgcagcgaagaacaaaccaagaca
ttatatgagaactatggtaaacccgacccgtcaaacgttgctaaagtgaaggatctctac
aaagagcttgatcttgagggggtgttcatggagtatgagagcaaaagctacgagaagctg
acgggagtgattgaggctcacgaaagtaaagcaatccaagcagtgctaaaatcattcctg
gcaaagatctacaagagacagaagtag

DBGET integrated database retrieval system