KEGG   Clostridium scindens: HDCHBGLK_02474
Entry
HDCHBGLK_02474    CDS       T06591                                 

Gene name
xdhA
Definition
(GenBank) Putative xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
csci  Clostridium scindens
Pathway
csci00230  Purine metabolism
csci01100  Metabolic pathways
csci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csci00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HDCHBGLK_02474 (xdhA)
Enzymes [BR:csci01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     HDCHBGLK_02474 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QBF75065
UniProt: B0NHD8
Position
2414376..2416679
AA seq 767 aa
MEERREVIGASVRRIDAFDKVTGYAKYTDDLCDKGAYIAKILHSTVANGKVISIDTEDAR
KIPGVIKVVTCFDVPKNYFPTAGHPWSTQESHQDVADRLILTDRVRFYGDDVAAVIAEDE
VVASQALRAIQVQYEEYPFVLDVKEAMEEGAPRLHEEYPGNVLKHTSIRNGNYEEAIKEP
GLIKVEGWYDTPSVQHCHIENFICYAYQVNHKMNVVSSTQIPHIVRRVVGQALGIPWGKV
RVIKPYIGGGFGNKQDVLYEPLCAYLSQVTGGHLVKLDVSREETFACNRVRHAIRSHIIS
YVRPDGTFAARKLEAFSNQGAYASHGHSIVAKGMGAFPQLYPCPNVEADSYTVFTNRPVA
GAMRGYGIPQAMFAVESHTDDVAKAIGMSPLEFRRKNLMPKGFVDGFSKNENYEDTFGQC
MDKAIAHTDYVRKAEAYSNQTGKIRRGIGIAAFWYNTAVWPISLESSSCRMVLNQDGSIQ
VQLGETEIGQGADTAFAQMAASTLGIPLEDVHVISNQDTDLTPFGTGAYASRQTYVGGFS
IQQTALLLKEKILGYAHEMTRMPAGILNIVDGMIVRKLDGRELLSMEELALEAFYSLSHS
QHITAESTYQIKSNAYSFGCTVAEVEVDIEACKVKLVDAVNVHDCGRLINPALAKAQVHG
GMSMGIGYGLSECLKFDPKTGKTLNGTLLDYKLSTTMDHPELKADFVENYEPTSAYGTKA
LGEPPVCSVAPAIRNAVFNATGVGVDTLPLSPHVLFEEFRKGGLLDV
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggaggaacgcagagaagttattggcgccagcgtaaggaggatcgacgcctttgacaag
gttacaggctatgcaaagtatacggacgacctctgcgacaaaggcgcatatatcgcgaag
atattgcattccacagtcgcaaacggcaaggtcatatccatagatacggaggatgccagg
aagataccgggcgtgatcaaggtggttacttgctttgacgtgccgaagaattattttcct
accgcaggccacccctggtctacgcaggaaagccatcaggacgtggcggaccgcctgata
ctgacggaccgtgtccggttctacggtgacgatgtggccgcggttattgcagaagacgaa
gtggtcgccagccaggctcttcgggccattcaggtacagtatgaggagtaccccttcgtg
ctggatgtaaaggaggccatggaagaaggcgcgcctaggcttcatgaggaatatccgggg
aatgtactgaagcataccagcatccgaaacggaaactacgaggaagccattaaggagccg
ggcctgatcaaagtggagggatggtacgatacgccttccgtgcagcactgccatatcgag
aactttatctgctacgcctatcaggtcaatcataagatgaatgtggttagttccacccag
atcccgcatattgtaaggagggtcgtaggccaggcgctgggaatcccctggggcaaggta
agagtcatcaagccatacatagggggaggattcggcaataagcaggatgtgctctatgag
ccgctgtgcgcctatctaagccaggtgacaggcgggcatctggtgaaactggatgtaagc
agggaagagacctttgcctgcaaccgggtaaggcatgccatccgaagccatattatatcc
tatgtcaggccggacgggacattcgcggccaggaaactggaggcgttctccaatcagggg
gcctacgcgtcccatggtcacagcatagtggcaaagggaatgggcgcgttcccgcagctg
tatccctgcccgaatgtggaggcagactcctatacggtatttaccaaccgcccggtggca
ggcgccatgagaggatatgggattccccaggctatgtttgccgtggagagtcatacggac
gacgtggcaaaggcgattggcatgtccccgctggaattcaggaggaagaacctgatgccg
aaaggattcgtggatggattctccaagaatgagaattatgaagatacctttggccaatgc
atggataaggcgatcgcgcatacggattatgtcaggaaggcagaagcatatagcaatcag
acgggaaagatccgaagaggcatcggaatcgcggcattctggtataatacggcggtatgg
ccaatctcattagagtcctcttcctgccgcatggtactgaatcaggatgggtccatccag
gtacagcttggagagacggagattggacagggggcggatacggcgtttgcccagatggca
gcatctacgctgggaatcccgctggaagatgtccatgtgatatccaatcaggacacggat
cttacgccgtttggaacgggagcctacgcttccaggcagacgtatgtgggcggcttttcg
atccagcagaccgcgctccttctaaaggagaagatcttaggctatgcccatgagatgaca
aggatgcccgctggaattctgaatattgtggacgggatgattgttagaaagttggatgga
agagaattgctgtccatggaagaactggcgctggaagcgttctacagcctgagccacagc
cagcatataacggcggagagcacttatcagatcaaaagcaatgcttattcctttggatgc
acggttgcggaagtggaggtggacatcgaggcctgcaaggtcaaactggtggatgcagtc
aatgtccatgactgcggcaggctgatcaacccggcgctggccaaggctcaggttcacggc
gggatgagcatgggaatcggatatggcctgtcagaatgcctgaagttcgatcccaagacc
ggaaagacgttgaacggaacgctgctggactataagctgtccactaccatggaccatccg
gaacttaaggcggactttgtagaaaactatgagcctaccagcgcgtacggaacgaaagcg
ctgggagagcctccggtctgttctgtggctccagctatccgcaatgcagtattcaacgcg
acaggagtcggcgtagacacgctgcctctaagtccccatgtcttattcgaggaattccgg
aaaggagggcttctggatgtatga

DBGET integrated database retrieval system