KEGG   Chlamydia trachomatis L2b/UCH-1/proctitis: CTLon_0671Help
Entry
CTLon_0671        CDS       T00646                                 

Definition
(GenBank) putative nucleotide-binding protein
  KO
K03979  GTPase [EC:3.6.5.-]
Organism
ctl  Chlamydia trachomatis L2b/UCH-1/proctitis
Brite
KEGG Orthology (KO) [BR:ctl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ctl03009]
    CTLon_0671
Enzymes [BR:ctl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     CTLon_0671
Ribosome biogenesis [BR:ctl03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   CTLon_0671
 Prokaryotic type
  GTPases
   CTLon_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP1_OBG MMR_HSR1 FeoB_N Arf GTP_EFTU SRPRB NOG1 Dynamin_N Gtr1_RagA ABC_tran AAA_18
Motif
Other DBs
NCBI-ProteinID: CAP07068
UniProt: B0BC53
Position
complement(806586..807593)
Genome map
AA seq 335 aa AA seqDB search
MFVDQITLELRAGKGGNGVVAWRKEKYLPKGGPYGGNGGNGGSILIETVTNMYSFEEYRN
LRFLKADDGQAGASNNRTGRNGKDLVLKVPEGTLLRDAATGELIHDFTKDGERIVVCQGG
RGGKGNVFFKTSTNRAPTKATPGKPGEIRLVELELKLIADIGLVGFPNAGKSTLFNTLAR
TEVKVGAYPFTTLHPSLGLVHQEGMLYQKTWIMADIPGIIEGASQNRGLGLDFLRHIERT
RLLLFVIDISGIERHSPEQDLKILMGELLAYKEELKDKDMVIALNKIDQLLPDEREERVA
LLKQQFPDQEFILLSGLTGEGVDALYDLFKSKLSE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttgatcaaattacattagagttgcgcgccgggaaaggcggtaatggtgttgta
gcttggagaaaagagaaatatctccccaaaggaggcccctacggcggtaatggggggaat
gggggctctattcttatcgaaacagtgacgaatatgtattcatttgaagaataccgtaat
cttcgtttccttaaagctgatgatgggcaagccggtgctagtaataatcgtacaggaaga
aacggtaaagacttagtattaaaagttcctgaggggactctcttacgggatgcagccact
ggagaattgatacacgatttcaccaaggatggtgaacgtattgttgtctgtcagggaggc
agaggaggtaaggggaatgttttctttaaaacatcgactaaccgagctccaacaaaagct
actccaggtaaacctggagaaattcgcttggttgaactggaactcaaattaatagctgat
atcggtctcgttggattccctaacgctggtaaatcaaccttatttaacactcttgcacgt
acagaagtgaaagtcggtgcctatccgtttaccacgctacatccttcattgggtttggtt
catcaagaaggaatgctctatcaaaaaacttggatcatggcagatattccaggaattatt
gaaggagcgtcgcaaaaccggggattgggattggatttccttcggcatattgaacgtacg
cgattactgttattcgtaatcgatatctctggaatagaaagacactcacccgaacaagat
cttaaaatcttaatgggggagctcttggcttacaaagaagagctaaaggataaagacatg
gtcatcgctttaaataagatcgatcagctactgcctgatgagcgcgaagaacgtgtagct
cttcttaaacagcagttccctgatcaagaatttattttgctttcagggctgacaggagaa
ggggtagatgcattgtatgatctgttcaagagtaaactcagtgagtaa

DBGET integrated database retrieval system