KEGG   Cycloclasticus zancles: CYCME_1270
Entry
CYCME_1270        CDS       T02780                                 

Definition
(GenBank) Dihydrodipicolinate synthase/N-acetylneuraminate lyase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
cza  Cycloclasticus zancles
Pathway
cza00626  Naphthalene degradation
cza01100  Metabolic pathways
cza01120  Microbial metabolism in diverse environments
cza01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cza00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CYCME_1270
Enzymes [BR:cza01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     CYCME_1270
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AGS39599
UniProt: S5T7N0
Position
complement(1276967..1277965)
AA seq 332 aa
MARRQDRLTVEDVNGAWAIIPTPAIETGDQWQTEDSVDYDEIARAVDGLIESGVDAIMSQ
GTFGEGATLTWEEKKKMMEVMVETSAGRVPIFVGVTTMNTRETIRQLRHARDIGADGTML
GLPMWQQIDVPAAVRFYQDVAEAVPEMAIAIYANPEAFKFDFPAPFWAQVANIPQVITCK
YINIGQLHLHTMVSKKQIRFLPLEIDHADAAKMDPEFNTAFWSPLACTGPELTIHWRDSV
REAAKTGDWSRPDELYPQMALALSSLFPPGGFAEFSKYNIQLEKARINAAGWMKAGPCRP
PYMTAPEHYLEGAAKSGTGWAELNKKLLEGTL
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctagaagacaagacaggttaacagtagaagatgtgaatggtgcgtgggcaatcatt
cctacaccagcgatagaaactggtgatcaatggcaaacagaagacagcgttgattatgac
gaaatcgctagagctgttgacggccttattgaatctggtgttgacgccatcatgagtcaa
ggaacttttggagaaggcgctacccttacttgggaagaaaagaaaaaaatgatggaagtc
atggttgaaacttcagccggacgagtacctatctttgttggtgttacaacaatgaatact
cgcgagactattcgtcaattacgtcatgcacgagatattggtgctgacggaacaatgtta
ggcttaccaatgtggcagcaaattgatgtacctgcagctgttcgtttctatcaagatgtt
gctgaagctgtgcctgaaatggcaatcgctatttacgctaacccagaagcatttaaattt
gatttcccagctccattttgggctcaagttgctaacattccacaagtcatcacttgcaag
tacataaatattggtcaactacacttgcacacgatggtttcaaaaaagcaaattagattt
ttgccactagaaatcgatcacgcagatgctgctaaaatggatccagaattcaacactgct
ttttggtcaccacttgcttgtacaggccctgagctaaccattcattggcgtgacagtgtt
agagaagcggctaaaacaggtgactggagtagaccagacgagctttacccacaaatggca
ttagcactgtctagcttattccctcctggaggctttgctgaattttctaaatataacatt
cagttagaaaaagcgcgtattaatgcagctggttggatgaaagcaggtccatgccgccct
ccttacatgacagcaccagagcactatttagaaggcgctgctaaatctggtacaggttgg
gctgagttaaataaaaaattacttgaaggcacgctttaa

DBGET integrated database retrieval system