KEGG   Desulfomicrobium baculatum: Dbac_0085Help
Entry
Dbac_0085         CDS       T00963                                 

Definition
(GenBank) thymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00240  Pyrimidine metabolism
dba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dba00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dbac_0085
Enzymes [BR:dba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     Dbac_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin AAA_17 AAA_18 AAA_28 MeaB ADK AAA_22 AAA_33 SRP54 ATP_bind_1 Viral_helicase1 RNA_helicase NB-ARC
Motif
Other DBs
NCBI-ProteinID: ACU88215
UniProt: C7LSK1
Position
complement(104215..104850)
Genome map
AA seq 211 aa AA seqDB search
MFLTFEGMEGCGKSTQCKKLIEHFVRQGHDVLHTLEPGGSRLGKELRRILLDPKNSDLSS
TSELFLYLADRAQHVSSVIRPAMEDGRTVICDRFADSTVVYQGYGRGLDPSLLHHLNDVA
VQGLWPDMTILLDVEPEIGLRRALTRNMQDNKTATEGRFEAESMAFHTRIREGYLTWAAL
HRGRFLVVDAGRNPDAVFDSILRGLEEKGLG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttacttttgaaggcatggagggctgcggaaaatccacgcagtgcaaaaagctc
atcgaacatttcgtgcgtcagggacacgacgtcctgcacactcttgagcccggcggcagc
cgcctgggcaaggaattgcgccgcatcctgctcgatcccaagaacagcgacctgtcctcc
accagcgaacttttcctgtatctggccgaccgcgcccagcacgtgtcctcggtcatccgc
ccggccatggaagacggacgcaccgtgatctgcgaccgctttgccgactccaccgtggtc
taccagggctacggacgcggccttgacccgagcctgttgcaccacttgaacgacgtggcg
gtgcagggactctggcccgacatgacgatcctcctggacgtggagccggagatcggcctg
aggcgcgccctgacccgcaacatgcaggacaacaagaccgccaccgaaggccgcttcgag
gccgagagcatggccttccacacccgcatccgcgaaggctacctgacctgggccgccctg
caccgcggccgcttcctggtcgtggacgcgggcaggaatccggacgccgtgtttgattcc
atcctgcgcggcctggaggaaaaaggccttggctaa

DBGET integrated database retrieval system