KEGG   Deinococcus soli: SY84_02060Help
Entry
SY84_02060        CDS       T04233                                 

Definition
(GenBank) 3-isopropylmalate dehydratase
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
dch  Deinococcus soli
Pathway
dch00300  Lysine biosynthesis
dch00680  Methane metabolism
dch01100  Metabolic pathways
dch01110  Biosynthesis of secondary metabolites
dch01120  Microbial metabolism in diverse environments
dch01210  2-Oxocarboxylic acid metabolism
dch01230  Biosynthesis of amino acids
Module
dch_M00433  Lysine biosynthesis, 2-oxoglutarate => 2-oxoadipate
Brite
KEGG Orthology (KO) [BR:dch00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    SY84_02060
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SY84_02060
Enzymes [BR:dch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     SY84_02060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521
Motif
Other DBs
NCBI-ProteinID: AKH16031
UniProt: A0A0F7JJ15
Position
complement(412903..414189)
Genome map
AA seq 428 aa AA seqDB search
MTNPTPRPQTMAEKILSRRGTHTVYAGDLAVVEVDQVMVVDSIAQSFIQRMQQDLGATPK
YPERVSIVIDHVAPASTVSVAQAQKEAREYAAQTGVRLFDVGRGICHQVLMEEGLARPGW
IVLGSDSHSTTYGAVAAFGSGMGATDIALAAASGKTWLKVPDSVKVTFTGDLRPGVTAKD
VALEMIRRLGADGATYQSIEMHAGDRFTRGERMTLANLCVEAGAKAGLVVPGGEILTAYG
YDIPEWVYPDEGATYVQSIEIDLGTLNPRMSAPSEVDNVFDVAQLREDLRDVHVDQVFIG
TCTNGRIEDLHAAADVLRGRRVAPGTRLLVIPASSQVMEDAMADGTLLTLQRAGAVLGTP
GCGPCMGRHQGVLAPGEVCVSTSNRNFIGRMGDKDARIYLASPAVAAATAVMGRVALPED
VLNTKVSA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaccctaccccccgcccgcagaccatggcggaaaagatcctctcccggcgcggc
acgcacaccgtgtacgccggtgacctcgcggtcgtcgaggtcgatcaggtcatggtcgtg
gactccatcgcccagagcttcatccagcgcatgcagcaggacctcggcgccacacctaaa
taccccgagcgggtcagcatcgtgatcgatcacgtcgcccccgccagcaccgtcagcgtt
gcgcaggcgcagaaggaagcgcgcgagtacgccgcccagacaggcgtgcgcctcttcgac
gtgggccgcggcatctgccaccaggtcctgatggaggaaggcctcgcccgccccggctgg
atcgtgctgggcagcgacagccactccacgacatacggggcggtcgccgcgttcggcagc
ggcatgggcgccaccgacatcgccctggccgccgcgagcggcaagacgtggctgaaagtc
cctgacagcgtcaaggtcaccttcacgggcgacctgcggcccggcgtgaccgccaaggac
gtcgcgctggagatgatccgccgcctcggcgcggacggcgccacgtaccagagcatcgag
atgcacgccggggaccgcttcacgcgcggcgaacgcatgaccctagcgaacctctgcgtg
gaggccggcgcgaaggccggactggtcgtccccggcggcgagatcctcaccgcgtacggc
tacgacatccccgaatgggtctacccggacgagggcgccacgtacgtgcagagcatcgag
atcgacctgggcaccctgaacccccgcatgagtgcccccagcgaggtggacaacgtgttc
gacgtcgcccagctgcgtgaggacctccgcgacgtgcacgtggatcaggtgttcatcggc
acctgcacgaacgggcgcatcgaggacctgcacgccgccgccgacgtgttgcgcggacgg
cgcgtcgcccccggcacccgcctgctggtcatcccggccagcagtcaggtcatggaggac
gccatggccgacgggaccctcctgaccctgcaacgcgccggggcagtcctgggcaccccc
ggctgcgggccgtgcatgggccgccaccagggcgtcctggcgcccggcgaggtctgcgtc
agcaccagtaaccgcaacttcatcgggcggatgggcgacaaggacgcccgcatctacctc
gcgtcgcccgccgtggccgccgcgaccgccgtcatgggccgcgtcgcgctgcccgaggac
gtcctgaacaccaaggtgagtgcgtga

DBGET integrated database retrieval system