KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10384
Entry
Dmel_CG10384      CDS       T00030                                 

Gene name
CG10384
Definition
(RefSeq) uncharacterized protein, isoform E
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: KH_1 SelP_N zf-RING_13 TFIIA
Other DBs
NCBI-GeneID: 37567
NCBI-ProteinID: NP_001163254
FlyBase: FBgn0034731
UniProt: Q9W249
Position
2R
AA seq 492 aa
METKAGLSALEERSLKGSEKLKMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGN
SMKRLQEDTMCKMAVLGRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHA
RIAYALAEVRRFLVPDYHDDIRQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGT
TNSSSNGASGRGLGGGLADMDTSNDDKSDDASGMECLSAVDKLDCSSSCASLGISGITTI
STTSPEHPHPHQHHQQHQQHQQHHAHLHPAHAHGNQQQQQQVQHHHSHQAHFHQLLQQAH
GGASAAAAACGEHLSGQTTPATAAALHTTAMAVALQHQLTAAGIGGLLKPATGVGATMAG
LPTTQAGAAALQLPGDGESSGSTLTLLEPPGTALLHPALRNVKTINIGGGLGRKRPLLGV
PRSGMNPTKRTVMSLLARAKNSQALHSVRQPMVTATSFAEPLQMLASPFIIPHRAVDQPI
LALSKESLAQGV
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggaaactaaagctggcttaagtgcgctggaggaaaggtccctgaaaggttcagagaaa
cttaaaatgctggacatcactcgcgacaagccggtgaaggtggccgtcaaagtggccgtt
cctgtgcgggatcacccaaagttcaatttcgtgggcaagctgctcggacccaagggcaac
tcgatgaagcgcctgcaggaggacaccatgtgcaagatggccgttctgggacgcggatcg
atgcgagaccggcggaaggaggaggagctgcggggcagtggcgacagtcgctacgcccat
ctcttcgaggacctgcacgtcgagatctcgaccttcgccgctccggcggaggcccatgct
cggatagcctacgctctggcggaagtgcgccgctttctggttccggactaccacgatgac
atccgccaggagcaaatgtgggaaatgcaggcgctgacgtccacgcccgcactgggtgcc
cactcgctggaggattcgcatagccctaccatcaacagcagtagccaggtgggcggcacc
accaactcctcctccaacggggccagtgggcgtggcctgggcggcggactagccgacatg
gacacgtccaacgatgacaaatcggacgacgccagcggcatggagtgcctgtcggcagtc
gacaagcttgactgctcgtccagctgcgccagtctgggcatcagtggcatcaccaccatc
agcaccaccagccccgagcatccgcatccgcaccagcaccaccagcagcaccaacagcac
caacagcaccacgcccacctgcacccagcacacgcccatggaaaccagcagcagcagcag
caggtccagcaccaccacagccaccaggcgcacttccaccagctcctgcagcaggctcac
ggtggagccagtgccgcagcggctgcctgcggggagcatctctctggacagacgactccg
gcgacggcggcggcattgcacaccacagccatggcagtggcactccagcatcagctcaca
gccgcaggaatcggaggactcctgaagccggccaccggagtgggggccaccatggccggg
ctgcccaccacccaggcgggagccgccgcccttcagttgcccggcgatggggagtcatct
ggatcgacgctcacgctgctggagccaccgggcaccgcactcctgcatcccgctctgcgc
aacgtcaagaccatcaacataggtggcggcctgggaaggaagcgtcccctgctgggtgtt
ccccgctccggaatgaaccccacaaagcgcacggtgatgagcctgctggccagggccaag
aactcgcaggcgctgcactcggtccgccaaccgatggtgacggccaccagtttcgctgaa
cccttgcagatgctggcctcgccgttcatcattccgcaccgggcggtggaccagccgatc
ctggcgctgtcgaaggagagcctcgcgcagggcgtctaa

DBGET integrated database retrieval system