KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11680Help
Entry
Dmel_CG11680      CDS       T00030                                 

Gene name
mle
Definition
(RefSeq) maleless, isoform A
  KO
K13184  ATP-dependent RNA helicase A [EC:3.6.4.13]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dme03041]
    Dmel_CG11680 (mle)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Dmel_CG11680 (mle)
Spliceosome [BR:dme03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    Dmel_CG11680 (mle)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dsrm Helicase_C OB_NTP_bind HA2 DEAD Dicer_dimer AAA_22 AAA_14 AAA_19 T2SSE
Motif
Other DBs
NCBI-GeneID: 35523
NCBI-ProteinID: NP_476641
FlyBase: FBgn0002774
UniProt: P24785
Structure
PDB: 

Position
2R
AA seq 1293 aa AA seqDB search
MDIKSFLYQFCAKSQIEPKFDIRQTGPKNRQRFLCEVRVEPNTYIGVGNSTNKKDAEKNA
CRDFVNYLVRVGKLNTNDVPADAGASGGGPRTGLEGAGMAGGSGQQKRVFDGQSGPQDLG
EAYRPLNHDGGDGGNRYSVIDRIQEQRDMNEAEAFDVNAAIHGNWTIENAKERLNIYKQT
NNIRDDYKYTPVGPEHARSFLAELSIYVPALNRTVTARESGSNKKSASKSCALSLVRQLF
HLNVIEPFSGTLKKKKDEQLKPYPVKLSPNLINKIDEVIKGLDLPVVNPRNIKIELDGPP
IPLIVNLSRIDSSQQDGEKRQESSVIPWAPPQANWNTWHACNIDEGELATTSIDDLSMDY
ERSLRDRRQNDNEYRQFLEFREKLPIAAMRSEILTAINDNPVVIIRGNTGCGKTTQIAQY
ILDDYICSGQGGYANIYVTQPRRISAISVAERVARERCEQLGDTVGYSVRFESVFPRPYG
AILFCTVGVLLRKLEAGLRGVSHIIVDEIHERDVNSDFLLVILRDMVDTYPDLHVILMSA
TIDTTKFSKYFGICPVLEVPGRAFPVQQFFLEDIIQMTDFVPSAESRRKRKEVEDEEQLL
SEDKDEAEINYNKVCEDKYSQKTRNAMAMLSESDVSFELLEALLMHIKSKNIPGAILVFL
PGWNLIFALMKFLQNTNIFGDTSQYQILPCHSQIPRDEQRKVFEPVPEGVTKIILSTNIA
ETSITIDDIVFVIDICKARMKLFTSHNNLTSYATVWASKTNLEQRKGRAGRVRPGFCFTL
CSRARFQALEDNLTPEMFRTPLHEMALTIKLLRLGSIHHFLSKALEPPPVDAVIEAEVLL
REMRCLDANDELTPLGRLLARLPIEPRLGKMMVLGAVFGCADLMAIMASYSSTFSEVFSL
DIGQRRLANHQKALSGTKCSDHVAMIVASQMWRREKQRGEHMEARFCDWKGLQMSTMNVI
WDAKQQLLDLLQQAGFPEECMISHEVDERIDGDDPVLDVSLALLCLGLYPNICVHKEKRK
VLTTESKAALLHKTSVNCSNLAVTFPYPFFVFGEKIRTRAVSCKQLSMVSPLQVILFGSR
KIDLAANNIVRVDNWLNFDIEPELAAKIGALKPALEDLITVACDNPSDILRLEEPYAQLV
KVVKDLCVKSAGDFGLQRESGILPHQSRQFSDGGGPPKRGRFETGRFTNSSFGRRGNGRT
FGGGYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGGYRNNGGGYGNNGGGY
GNKRGGFGDSFESNRGSGGGFRNGDQGGRWGNF
NT seq 3882 nt NT seq  +upstreamnt  +downstreamnt
atggatataaaatcttttttgtaccaattttgtgctaagtcgcaaatagaaccaaagttt
gatattcgccaaacgggtcccaaaaatcgccagcggttcctttgcgaggttcgtgtagag
ccaaatacctatattggtgtgggtaattccactaacaaaaaggatgccgagaaaaatgcg
tgccgtgattttgtcaactacctagtgcgcgtgggcaaactgaacaccaatgatgttcca
gcggatgctggtgcttcggggggcggacctaggactggtctggagggtgcgggcatggca
gggggcagtggacagcagaagcgagtgtttgatggtcagtcgggtccacaggatctgggt
gaggcctatcgccctctaaaccacgatggcggtgacggcggtaaccgctactcagtaatt
gatcgcatccaggagcagagggacatgaacgaagcggaggctttcgatgtcaacgctgcc
atccacggtaactggaccatagagaatgccaaagagcgactgaacatttacaagcagacg
aacaacattcgcgacgattacaaatatacaccagtgggcccggaacacgctaggagcttt
ttggccgaattgtccatttatgtgccggcgctcaatcgcacggtgacggcccgtgagtcg
ggttcaaacaagaagtctgccagcaagtcatgcgccctgtccctggtgcgccaacttttc
catttaaatgtgatagagccctttagtggaactctgaagaaaaaaaaggatgagcagctg
aagccatatccggtgaagctttcgccaaatctgataaacaaaattgatgaggtgattaag
ggtttggaccttcctgtcgtaaacccgcgcaatatcaaaatcgaactggacggtcctccg
attcctctcattgtgaacttaagccgtatagattcctcgcaacaggatggcgaaaaacgt
caggaaagctccgtgattccgtgggctcctcctcaggcaaactggaatacgtggcatgcc
tgcaacatcgacgaaggcgaactggcaaccacctctattgatgacctttcgatggactac
gaacgctcgctgcgtgatcgccgccaaaacgacaacgagtaccgacaattcctcgagttc
cgcgaaaagctgcccattgcagcgatgcggtcggaaattttaaccgcaattaatgacaat
ccagtggtaatcattcgtggaaacacagggtgcggaaagactacccagattgcccaatac
attcttgatgactacatctgctccggccagggcgggtacgctaatatttatgtgacccag
cctcgtcgcatttcagccatttctgtggccgagcgcgtagctcgcgagcggtgcgagcaa
ttgggcgacactgtaggctactcggtgcgatttgagtctgtgtttccacgaccctacggc
gcaatcctcttttgcaccgtgggtgtgttgctgcgcaagctggaggctggcttacgagga
gtgtcgcatattattgtggacgaaatccacgagagagacgtgaacagcgactttttgctg
gtcatccttcgcgacatggtcgacacatatccggacctgcatgttattcttatgtcggcc
actattgatacaacgaaattttccaaatattttggcatctgtcccgtattggaagtaccc
ggaagagcatttcccgtgcagcaatttttcttggaggacattattcagatgacagacttt
gtgccttcggcggagtcgcgccgaaagcgcaaggaagtggaggacgaggagcaattgctt
tccgaggacaaggacgaggcggaaatcaactataacaaggtgtgcgaggacaagtattca
caaaagactcgaaatgctatggccatgctatccgaatcggacgttagctttgagctgctg
gaggcattattgatgcatattaagtcaaaaaatattcccggtgctatcttagtattcctg
cccggttggaacctgatctttgcgcttatgaagtttctgcaaaatacaaacatttttggt
gatacatcccaataccaaattttgccgtgccactcgcagattccacgagacgagcaacgc
aaggttttcgagcctgttccagaaggcgtaaccaagattatactttctaccaacattgca
gagacttctataactattgacgacattgttttcgtaattgatatatgtaaggcgcgcatg
aagctctttacttcacataacaacctaaccagctacgccaccgtttgggcaagcaaaacc
aatttggagcagcgcaagggccgagctggacgtgtccgaccaggcttctgcttcacactc
tgttcgcgtgcccgcttccaagcgctagaggacaatcttacgccggagatgttccgcaca
ccgttgcacgagatggcgttgaccattaaattactcagactgggctccattcaccacttt
ttgtcaaaggcattggagccacctccggtagacgcagtaatcgaagctgaggtgttgctt
cgcgagatgcgctgccttgacgctaacgatgaacttactccattggggcgcctgctggca
cgcctcccaattgaaccaagacttggaaagatgatggtcctcggcgcagtatttggctgc
gccgatctaatggccattatggcttcgtactctagcaccttctcagaggtgtttagtctt
gatataggtcaacgtcgcctggcaaatcatcagaaagcgttgagtggtaccaaatgttcc
gaccacgtggcaatgattgtagcttcacaaatgtggcggcgcgagaaacaacgcggtgag
catatggaagctcggttctgtgactggaaaggactgcaaatgagtactatgaacgttatc
tgggatgccaagcagcagttactggatctccttcagcaggcaggattcccagaagagtgt
atgatatcgcacgaggtagacgaaaggattgatggggatgaccccgtgctggatgtgtcc
ctggcgctgctgtgcttgggtctctaccccaacatttgcgtgcacaaggagaagcgcaaa
gtgctgactacagagtctaaagcagcgttactgcacaaaacctcggtgaattgcagcaac
ttggccgtcacatttccgtatccgttcttcgttttcggcgagaagattcgcacgcgagct
gtttcctgcaagcaactatctatggtctcgcccttgcaggtgatattgtttggatcgcgc
aagattgacttggccgccaacaatatagtgcgcgttgacaactggcttaacttcgacata
gagccggaacttgcggccaagattggtgcccttaagccggccctggaggatcttatcacg
gtggcgtgcgacaacccttccgacatacttcgccttgaggagccctatgcacagctggtc
aaagtggtcaaagacctttgcgttaagagcgccggagacttcggactgcagcgtgaatca
ggaattctgccgcaccaatcacgtcagttcagtgacggcggaggaccgcccaaacgaggt
cgctttgagacaggacgctttactaacagcagctttggtcgccgtggaaacggcagaact
tttggaggaggatatggaaataatggaggaggatatggaaataatggaggaggatatgga
aatattggaggaggatatggaaataatgcaggaggttatggaaataatggtggatatgga
aataatggcggaggttatagaaataatggtggaggatatggaaacaatggcggaggatat
gggaacaagagaggtggatttggagactcatttgaaagcaatagaggatcaggcggcggc
tttagaaatggcgaccaaggcggccgctggggtaacttttaa

DBGET integrated database retrieval system