KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1454
Entry
Dmel_CG1454       CDS       T00030                                 

Gene name
wdn
Definition
(RefSeq) wings down
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-C2HE Zn-ribbon_8
Other DBs
NCBI-GeneID: 43398
NCBI-ProteinID: NP_476900
FlyBase: FBgn0005642
UniProt: P15619
Position
3R
AA seq 869 aa
MEGGKGEGKRMKEEAPSKKLPPKIYGGDAGTPTKAAHDEILSSLLRINNFDSISSIKDES
LDIDLSACVTISSASLVNGNSLSSTDFWRVLDESAQNNTELNLSSDVCRDDLAATSSSTV
PSTLTSDNHSSSEFSVTFLRPEPPNAFTNSPFKKTSSSGTSTPVKLSPEQLHQQHQLQMP
QSQLLQRKPKLPAATAVRLKVFKEEPPEEKHPPEQVVTKVEVCESELLPPSFTIFQQAKS
AESVADAASMPPPAASETKPLEVDPAPLHKCLDCNGLLLETPDEVAKHEAAAHRLRLTYR
CSECQREFELLAGLKKHLKTHRTEGRKDTWKKCPDCGKCLKLGSMWMHRKIHSDNKKYQC
DICGQKFVQKINLTHHARIHSSEKPYECPECQKRFQERSHLQRHQKYHAQTRSYRCEKCG
KMYKTERCLKVHNLVHLEQRPFACTVCDKSFISNSKLKQHSNIHTGMRPFKCNYCPRDFT
NFPNWLKHTRRRHKVDHKTGEHLENIPSYCSKKSTTNKAQKAAAAAAAAAAASSAVNPNE
LSASSELKAKANLTSTAAPAPAKQARKKKQPQQATLAALGITLPAGTALQQVHPVPLAQQ
HQQELTTVLVPLAPPAPKQTKAKRERKQLAPKQLQQKPQLLQQGQPQQSSLEPIPAVPQI
KKEPVQTQGPFLDLHGLSLTSAEELIMEQALEMEECGLYDAPNANTEMGTSDNAISDSAA
ALHFQIKNELPDELLPDDDFLPCKPSDRLPCPSLESSPFSSPASMELTAVSCASSVAIST
NALPVRSGNYYLPAFTLNAHGKLSSTGNGVQSVTTSLAQTPSVSMVNVPLLVRSNQMLPS
VDTLLFTNQTGGSRFFAGKSATAATPHLT
NT seq 2610 nt   +upstreamnt  +downstreamnt
atggaaggcggcaagggcgagggcaagagaatgaaagaggaggcgccaagcaagaagttg
ccgcctaaaatctacggcggcgatgcgggcacccccacgaaggcggcccacgacgagata
ctcagctctctgctgcggatcaacaacttcgactcgatatcgagcatcaaggacgagtcg
ctggacatcgatctgtcggcgtgcgtgaccatcagctccgccagcctggtcaatggtaac
agtctctcctccaccgacttttggcgcgttttggacgagagtgcccagaacaacaccgag
ctgaatctatcctcggacgtctgccgcgatgacttggctgccaccagctcgtcaaccgtg
cccagcactctgaccagtgataaccactccagctcggagtttagtgtgactttcctgcgg
cccgagcccccgaatgctttcactaattccccgtttaagaagacttcgtccagcggcacc
tccacacccgtaaagctatcgcccgagcagctccaccagcagcatcagctccaaatgccc
cagtctcagctgctgcaacgcaagccaaagctgccggcggcgacggcggtgcgtctgaag
gtctttaaggaggagccgcccgaggagaagcatccgccggagcaagtggtcaccaaggta
gaggtgtgcgagtctgagctgctgccgccatcgtttaccatattccagcaggccaaatcg
gctgaatcggtggcggatgcggctagcatgccgcctccggctgcttcggaaacgaagccg
ttggaggtggacccggcacctctacacaagtgtctcgactgcaacggactgctgctggag
acgcccgatgaggtggccaagcatgaggcggccgctcacaggctgaggctcacctatcgt
tgcagcgagtgccagcgggaattcgagttgttggctggtttgaagaagcacctaaagacg
caccgcaccgagggccgcaaggacacctggaagaagtgtcctgactgcggcaagtgcctc
aaattgggaagcatgtggatgcatcggaagattcacagcgataacaagaagtaccagtgc
gacatctgcggccaaaagtttgtgcaaaaaataaacctcacgcaccacgcacggattcac
tcatcggagaagccgtacgagtgtcccgagtgtcagaagcgattccaggagcgctcacat
ctgcagcgccaccagaagtaccatgcgcaaacgcgttcctatcgttgcgaaaagtgcggc
aagatgtacaaaacggagcgctgtctcaaggtccacaacttggtgcatcttgagcagcga
ccattcgcgtgcacagtgtgcgacaagagcttcatcagcaattcgaagcttaagcagcac
tccaacatacacacaggaatgcgcccgttcaaatgcaattattgtccgcgagacttcacc
aacttccccaattggttgaagcacacgagacgccgacacaaggtggaccacaaaacgggc
gaacacctcgagaacattccctcctactgctctaaaaagtccactacaaacaaggcccaa
aaggcagccgcggcagcagcagcagcggcggcagcatcttcagctgtgaatcccaacgaa
ctctccgcttctagtgaacttaaagccaaggctaatcttacgtctactgctgcaccggct
cctgcaaaacaagcgcggaaaaagaagcagccgcagcaggccactcttgctgcattggga
ataactctacctgccggtactgctctgcagcaagtgcatcctgtgccgctggcgcaacag
catcagcaggaacttaccactgtgctggtgccgctggccccgccggctcctaagcagacc
aaagccaagcgagaacgaaagcagctagcaccgaagcaactgcagcaaaaaccgcagctg
ctgcaacagggccaaccccagcagtccagcttagagcccattcctgctgtgccgcaaatc
aagaaggagccagtgcagactcagggtccgttccttgacttacacggtcttagtctgact
tcagccgaagagctgatcatggagcaggccctggagatggaggagtgcggtctgtacgat
gctcctaatgcaaacactgaaatggggacgtcggacaacgccatttccgattcggccgct
gccctgcacttccagataaagaatgaattaccggacgagctgttgccagacgatgacttc
ttgccttgtaagcccagcgaccgactaccttgcccctcactggagtcctcgccgttttcg
tcacccgcctccatggagctgaccgctgtctcatgcgcctccagtgtcgccatatcgacg
aatgctctaccagtgcgatctgggaactactatctacccgcctttacgctgaatgcacac
ggaaagcttagtagtacgggcaatggtgttcagtctgtgaccacgagcttggcccagaca
ccctctgtgtccatggtgaatgtgcctcttctggtgagatccaatcagatgctgccctca
gttgacacgctactcttcaccaaccagacaggcggaagtcgattctttgcggggaaatcg
gcgactgcggccacgccgcatctgacatga

DBGET integrated database retrieval system