KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18361Help
Entry
Dmel_CG18361      CDS       T00030                                 

Gene name
dsh
Definition
(RefSeq) dishevelled
  KO
K02353  segment polarity protein dishevelled
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
dme04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG18361 (dsh)
   04330 Notch signaling pathway
    Dmel_CG18361 (dsh)
   04150 mTOR signaling pathway
    Dmel_CG18361 (dsh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIX Dishevelled PDZ DEP TFIIA PDZ_6 PDZ_2 PIP5K MMR1 DUF2722 RR_TM4-6 Plasmodium_Vir Spt20 Lin-8 eIF-3_zeta Ndc1_Nup Suf DUF775 EPL1
Motif
Other DBs
NCBI-GeneID: 32078
NCBI-ProteinID: NP_511118
FlyBase: FBgn0000499
UniProt: P51140
Position
X
AA seq 623 aa AA seqDB search
MDADRGGGQETKVIYHIDDETTPYLVKIPIPSAQVTLRDFKLVLNKQNNNYKYFFKSMDA
DFGVVKEEIADDSTILPCFNGRVVSWLVSADGTNQSDNCSELPTSECELGMGLTNRKLQQ
QQQQHQQQQQQQQQQHQQQQQQQQQQVQPVQLAQQQQQQVLHHQKMMGNPLLQPPPLTYQ
SASVLSSDLDSTSLFGTESELTLDRDMTDYSSVQRLQVRKKPQRRKKRAPSMSRTSSYSS
ITDSTMSLNIITVSINMEAVNFLGISIVGQSNRGGDGGIYVGSIMKGGAVALDGRIEPGD
MILQVNDVNFENMTNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPID
PGAWVAHTQALTSHDSIIADIAEPIKERLDQNNLEEIVKAMTKPDSGLEIRDRMWLKITI
PNAFIGADAVNWVLENVEDVQDRREARRIVSAMLRSNYIKHTVNKLTFSEQCYYVVNEER
NPNLLGRGHLHPHQLPHGHGGHALSHADTESITSDIGPLPNPPIYMPYSATYNPSHGYQP
IQYGIAERHISSGSSSSDVLTSKDISASQSDITSVIHQANQLTIAAHGSNKSSGSSNRGG
GGGGGGGGNNTNDQDVSVFNYVL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggacaggggcggcgggcaggagacgaaggtgatataccacatcgacgatgag
acgacgccgtatctggtgaagatccccattccatccgcccaggtgacgctgcgcgatttc
aagctggtgctgaacaagcagaacaacaactacaagtacttcttcaagtcaatggacgcc
gatttcggtgtggtcaaagaggaaatagccgacgactccaccatactgccctgcttcaat
gggcgagtggtgtcctggctggtctccgccgatggtaccaatcagtcagataactgctcc
gagctgccaaccagtgagtgtgaattgggcatgggtctgaccaacaggaagctacagcag
caacagcagcagcatcagcagcagcaacaacaacagcagcagcagcaccagcaacagcaa
caacaacagcagcagcaggtgcagcctgtccagctggcgcagcagcaacagcagcaggtg
ctccatcaccagaagatgatgggcaatccgctgctgcagccgccaccgctcacatatcaa
tcggcatccgtgctctccagcgatctggactcgaccagtctctttggcaccgaatccgaa
ttgacgctggaccgcgacatgaccgactatagcagcgttcagcgattgcaggtgcgcaag
aagccgcagaggcgcaaaaaacgggcgcccagcatgtcgcgcacctcctcgtacagctcc
ataaccgactcgaccatgtccctaaatatcattaccgtctccatcaacatggaggcggtc
aactttctgggcatatccattgtcgggcaatcgaatcgcggcggcgacggcggcatctac
gtgggcagcatcatgaaaggcggcgcagtggcactcgatggacgcatcgaaccgggcgac
atgatcctccaagtgaacgatgtcaacttcgagaacatgaccaacgacgaggcggtacgt
gtgctgagagaagtcgttcagaagccgggacccatcaagctggtggtggccaagtgctgg
gacccaaatcccaagggctacttcaccattccgcgcacggagccggtgcgacccatcgat
cccggtgcttgggtggcgcacactcaggccctcacatcgcacgacagtattattgccgac
attgcggagccgattaaggagcgtctggaccagaataacctcgaggagatcgttaaggcg
atgacgaagccggacagcggcctggagatcagggatcgcatgtggctaaagataacgatt
cccaatgcatttatcggcgccgatgcggtcaattgggtgctggagaatgtggaggatgtt
caggataggcgggaggcgcgaaggatcgtctcggcgatgctgcgcagcaattacatcaag
catacggtcaataagttgaccttctcggagcagtgctactacgtggtgaacgaggagcgc
aatcccaatctgttgggccgaggacatctgcatccgcaccagctgccgcacgggcatggc
ggccatgcgcttagccatgcggacaccgagagcatcaccagcgacatcgggccgctaccg
aacccgcccatttatatgccatattcggccacgtacaatccaagtcacggctatcagccg
atccagtacggcatcgccgagcgacacatctcgtcgggatcgagtagcagcgatgtgctg
accagcaaggatatctcggcgtcgcagagcgacatcacctcggtgatccatcaggccaac
cagctgaccatcgccgctcatggctctaacaaatcatccggctcctccaatcggggcggc
ggcggaggcggtggcggtggcggcaacaataccaacgatcaggacgtatccgtatttaat
tacgtattgtag

DBGET integrated database retrieval system