KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2711
Entry
Dmel_CG2711       CDS       T00030                                 

Gene name
dwg
Definition
(RefSeq) deformed wings
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-AD zf-met zf-C2H2_jaz zf-C2H2_8 zinc_ribbon_15
Other DBs
NCBI-GeneID: 31265
NCBI-ProteinID: NP_477338
FlyBase: FBgn0000520
UniProt: Q9W4V9
Position
X
AA seq 592 aa
MMNSKIAEVVVLNCRTCTRACKLHKPLQEEIDLGSEGSTTLASMLNYCTGLSFEPQDGAA
MPQHICLHCLQLLEQAFNFKRMVIDSDELLRLGLDEARCSSFHESQTHSPNQSQQHDQQQ
QAFDSTEEYVMIEMLNEEQENVANLDEELAEEDRRIFAMTVDEEEEFLTEEVDQDDELSE
EEHQLAQSGDQQEEHITMESVHEFQPAEVEYVTIKNEFETIVTEEDEFEVMNDSGAHDAI
LDCQMIVIPAEGAIDEVIGEETLELEGDGREEHLLPEAEDVCEDEDFLEESLDSAPPTAG
EALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKP
HQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACD
LCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGH
AFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVAVQSINP
PSRQAGAEGATGGGATGGSPTGGGATGGSATNLHITEVHEQPVSTSKVVMVL
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgatgaatagcaagatcgccgaggtagtggtgctcaactgccggacgtgcacgcgtgcc
tgcaagctgcacaagccgctgcaggaggagatcgatctgggttcggagggcagcaccacg
ctggccagcatgctaaactactgcacgggactctcgttcgagccgcaagacggcgccgcc
atgccgcagcacatctgcctccactgcctgcagctgctggaacaggcgttcaacttcaag
cgcatggtcatcgattcggacgagctgctccgcctgggcctggacgaggcgcgctgctcc
agctttcacgagagtcagactcatagccccaaccagagccagcagcacgaccagcaacag
caggcgttcgactccaccgaggagtacgtcatgatcgagatgctcaacgaggagcaggag
aacgtcgccaatttggatgaagaactagcagaggaggatcgtcgcatcttcgcgatgacc
gtggatgaggaggaggagtttctcaccgaggaggtggatcaggatgacgagctgtcggag
gaggagcaccagctggcacagtcgggcgaccagcaggaggaacacatcactatggagagc
gtgcatgagtttcagcccgccgaagtggagtatgtgaccattaagaatgagttcgaaacg
atcgtcacggaggaggatgagttcgaggtgatgaacgactccggcgcccacgacgccata
ctggactgtcagatgattgtgatacccgccgagggagccattgacgaggtcatcggcgag
gagaccctcgaattggagggggatgggcgcgaggagcatctgctgccggaggcggaggat
gtctgcgaagatgaggacttcctggaggagtcgctggactcagcgccgccgaccgctggc
gaggcgctgccgtacgtgtgcaccgtgtgccagaaggcgttccgccagcagtgccgtctc
aaccagcacatgcgctcccacgtggacgagaagcaatacgagtgcgaggagtgtggcaag
cgtctgaagcacctacgcaactacaaggaacacatgctgacacacacaaatgtcaagccg
caccagtgcagcatatgcggccgcttctatcgtaccacctccagtctggcagtgcacaag
agaactcatgcggagaagaaaccctacaactgcgatcagtgcggccgcggatatgcggcg
ttcgatcatctgcggcgccacaagctcacgcacacgggcgagcgaccatacgcctgcgat
ctgtgcgacaaggcctactacgattcgtcctcgctgcgccagcacaagataagccacacc
ggcaagaaggctttcacctgcgagatctgcggcgtgggactgtctcagaagtcgggctac
aagaagcacatgatggtccacagtggcgtcaaggcgcacaagtgtgatgtttgcgggcat
gccttcacctttaccagcaacctcaatgcccatgttcgcctccattccggcgaaaagccg
tttaagtgcgaggtctgcgttaaggcctttcccacaaagaagcgactggccagtcatatg
cgcgtccacaacaaggagtcgccggtgacggccaccgttgctgttcagtccatcaatcct
cccagccgacaagcgggcgcagaaggtgcgacaggcggaggtgcgacaggtggaagtccg
accggtggaggtgcgaccggtggatcggcaaccaaccttcacataaccgaagttcatgag
cagccggtgtccacctccaaagtggtgatggtgctgtga

DBGET integrated database retrieval system