KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4145Help
Entry
Dmel_CG4145       CDS       T00030                                 

Gene name
Col4a1
Definition
(RefSeq) collagen type IV alpha 1, isoform A
  KO
K06237  collagen, type IV, alpha
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04512  ECM-receptor interaction
dme04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dmel_CG4145 (Col4a1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmel_CG4145 (Col4a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG4145 (Col4a1)
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG4145 (Col4a1)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dmel_CG4145 (Col4a1)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   Dmel_CG4145 (Col4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 33727
NCBI-ProteinID: NP_723044
FlyBase: FBgn0000299
UniProt: P08120
Position
2L
AA seq 1779 aa AA seqDB search
MLPFWKRLLYAAVIAGALVGADAQFWKTAGTAGSIQDSVKHYNRNEPKFPIDDSYDIVDS
AGVARGDLPPKNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQ
KGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGL
SGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGD
SGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDM
GQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEP
GLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGL
NGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGP
EGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAG
APGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPG
ERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPG
APGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSI
KGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDG
SPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNG
QPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGV
SGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGA
PGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGI
KGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGP
AGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEK
GSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFT
GAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGD
RGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLI
GERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFK
GERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPK
GRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEK
GERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGILITR
HSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNV
CNYASRNDKTFWLTTNAAIPMMPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPN
GWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSF
WMYNLESSQPFERPQQQTIKAGERQSHVSRCQVCMKNSS
NT seq 5340 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccttctggaagcggctgctatacgccgctgtgatcgcgggagcgttagtcggt
gccgacgctcaattttggaagacggctggtacggccggttcgattcaggactccgtgaaa
cactacaatcgaaatgaacccaagttcccaatcgacgacagttacgacattgtagactct
gccggcgtggcgcgcggcgatctgccgcccaagaattgtacggccggatatgcgggctgt
gtgcccaagtgcatagcggagaagggcaaccgtggtctgccgggccctcttggacccacg
ggattgaagggcgaaatgggtttccctggcatggagggaccatctggtgacaagggtcag
aagggtgatcccggcccatacggacagcgtggtgataagggtgagcgcggatcgcctggt
cttcatggtcaggctggtgtacccggagtccagggacccgccggcaatcccggagcccct
ggtatcaacggtaaagacggttgcgacggacaggatggtattcctggcttggagggtcta
tccggaatgcccggacctcgcggatatgccggccagcttggcagcaagggcgagaagggt
gaaccggcaaaggagaacggtgattacgcgaagggcgagaagggtgagcccggttggagg
gggactgccggtttggctggaccacaaggatttcctggagaaaagggcgagcgcggcgac
agtggaccttacggagccaaaggaccccggggtgagcacggtctgaagggagagaagggt
gcctcctgctacggacccatgaagcctggtgcaccgggtatcaagggcgagaagggtgag
cccgcgtcctcgtttcccgtcaaaccgacccacacggtgatgggacctcgcggcgatatg
ggacagaagggagagcctggcctagttggccgcaagggtgagcccggacctgaaggcgac
actggactcgatggacagaagggcgagaagggtctgcccggcggcccaggcgatcgcggt
cgccaaggtaactttggacccccaggatctacaggacaaaagggagatcgtggcgagccg
ggccttaatggtctgcccggtaatcccggacagaagggtgagccaggacgtgctggagcg
acaggtaagcctggtctgctcggtcctccgggaccgccaggcggtggccgtggaacacca
ggacccccgggacccaaaggaccccgcggctatgttggcgcacctggaccccagggatta
aacggagttgatggactaccgggtcctcagggatacaatggacaaaagggaggtgctggt
ctgcccggtcgccccggcaacgagggacctcctggcaaaaagggagaaaagggaaccgca
ggacttaatggaccaaagggatccatcggacccattggacacccaggaccaccgggacca
gagggacagaagggtgacgccggtttgcccggttatggcattcaaggatctaagggagat
gctggcatacctggttatcccggactaaagggtagcaagggagagcgcggcttcaagggc
aatgctggtgctcccggtgactccaagctgggtcgtcctggaactcccggtgccgctggt
gctcctggacaaaagggagacgctggtcgtcccggcactcctggccaaaagggagacatg
ggtatcaagggtgacgtcggcggcaaatgctcatcgtgcagggccggaccaaagggtgat
aagggaacgagcggactgcctggaattcccggaaaggatggcgcacgaggaccgcctgga
gagcgcggatatcccggagagcgtggacacgatggaatcaacggacaaactggaccgcct
ggtgagaagggagaggacggtcgcactggtcttcccggagcaactggagagcctggcaaa
cctgctctgtgcgatttgagtttgattgagccattgaagggtgacaagggttaccctggt
gcgccaggtgcaaagggcgtgcaaggattcaagggagcagaaggtctgcctggtatccct
ggacccaaaggagaattcggtttcaagggtgagaagggtttgagcggagcacccggcaac
gacggaacacccggacgcgctgggcgggacggataccccggaattcccggtcaatccatc
aagggcgagccaggcttccatggaagggacggagcaaagggcgacaagggatcatttggc
cgaagcggcgagaagggagagcccggtagctgtgcgcttgacgaaattaagatgcccgcc
aagggtaacaagggtgagcccggccaaaccggcatgccaggacctccgggagaagacggc
agcccgggagagaggggctataccggattgaagggcaacactggaccacagggacctcct
ggcgttgaaggaccccgcggcttgaatggacctcgcggtgaaaagggcaaccagggcgct
gtcggagtacctggtaatcctggcaaggacggccttcgcggcattcccggacgcaatgga
cagcctggaccgaggggagagcctggtatttcgagacccggccctatgggcccacccggt
ctcaatggtctgcaaggtgagaagggcgaccgtggtccaaccggacccattggttttccc
ggtgccgatggcagtgtgggatatcctggagatagaggcgatgccggtctgcccggagta
tctggacgtcccggaattgttggtgagaagggagacgtgggcccgatcggacccgctggt
gttgccggacctcctggtgttcctggtattgatggtgtgcgtggacgtgatggcgccaag
ggtgagcccggcagtcccggattggtcggcatgcccggtaacaaaggtgaccgtggtgct
cctggaaatgacggacccaagggctttgctggcgttactggtgctcccggaaagcgcgga
cctgctggtattcccggagtttccggtgccaagggtgacaagggcgctactggcttgact
ggcaacgatggacctgtgggaggccgcggtcctccaggtgctcctggactgatgggcatt
aagggtgaccaaggattggcaggcgcccctggacaacaaggactggacggtatgcctggc
gaaaagggtaaccaaggattccccggtctggatggacctcctggtttgcctggagatgcc
tccgagaaaggacaaaagggtgaacccggtccatccggactccgcggcgatacaggtccg
gccggaacgcccggttggccaggagagaagggtttgcccggtctggctgttcacggtcgt
gctggtccgccaggcgagaagggtgaccagggacgcagtggaatcgatggacgagatgga
attaacggcgagaagggtgaacaaggtctgcagggcgtttggggccagcctggcgagaag
ggatctgtcggcgcacctggtattcctggtgctcccggaatggatggtttgcccggcgct
gctggtgctcctggtgctgttggctatcctggtgatcgcggtgacaagggagagcctggt
ctatctggtctgcccggactcaagggtgagactggacccgttggactgcagggcttcacc
ggtgctcctggccctaagggtgagcgcggtattcgtggtcagcccggtcttccggccacc
gttcccgacatccgtggtgataagggatcccagggcgagcgcggctacactggcgagaag
ggcgagcaaggcgaacgaggcttgactggtcctgctggcgtcgctggagcaaagggagat
cgcggattgcagggaccaccaggtgcaagcggattgaacggcattcccggagccaaggga
gacattggtccaagaggcgagatcggttatccaggagttaccattaagggcgagaagggt
ctgcccggtcgcccaggcagaaacggacgtcaaggtcttattggagcacccggcttaatt
ggagaacgtggtctgcctggcttggccggagagcccggcctcgtgggcctgcctggaccc
attggaccagctggcagcaagggagagcgtggtctcgccggcagtcccggacaaccagga
caggatggcttccccggcgcacctggattgaagggagatactggaccgcagggctttaag
ggcgaacgtggtctgaatggcttcgagggacaaaagggagacaagggtgaccgaggactc
caaggaccgtctggactgcccggcttggttggacagaagggagataccggctaccctggc
ttaaatggaaacgatggacctgtcggagctcctggcgagcgcggcttcaccgggcccaag
ggacgcgatggacgcgacggaacaccaggtctgcctggacagaagggtgaaccaggaatg
ctgccaccaccaggacccaagggcgaacctggtcagccgggacgcaatggacctaaggga
gagcccggacgtccgggagagcgtggcttgattggcatccagggtgagcgtggcgaaaag
ggtgagcgcggcctgatcggtgagactggtaacgtgggacgacccggacccaagggagat
cgcggagagccaggcgagaggggatatgagggcgccattggtttgatcggccagaagggt
gagcccggtgctccagcccccgctgctctggactatctcaccggtatcctgattacgcga
cacagtcaatcggaaacggtgcccgcttgctcggctggacacacggaactgtggacgggt
tactccctgttgtacgtcgatggcaatgactatgcccacaaccaggaccttggatccccc
ggatcctgtgtgccacgcttctcaacgctgcccgtactgtcgtgtggtcagaataacgtc
tgcaactacgcctccagaaatgacaagaccttctggctgacaaccaacgccgccattccg
atgatgcccgttgaaaacatcgagatccgccagtacatctcacgttgcgtcgtttgtgag
gcgccggctaatgtgatcgccgtgcacagtcaaacgatagaggtgcccgactgtccgaat
ggctgggagggtctctggattggctacagtttcctcatgcacactgccgtgggcaacggt
ggcggtggacaggcgctgcaatcgcctggctcctgtttggaggacttccgtgcaacgccc
ttcatcgagtgcaacggcgccaagggcacgtgccacttctatgagacgatgacaagcttc
tggatgtacaacctggagtcctcacagccgttcgagaggccacagcagcagacgatcaag
gccggcgagcggcagtcgcatgtgtccaggtgccaggtgtgcatgaagaactcctcgtag

DBGET integrated database retrieval system