KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4192Help
Entry
Dmel_CG4192       CDS       T00030                                 

Gene name
kek3
Definition
(RefSeq) kekkon 3, isoform B
  KO
K07523  netrin-G1 ligand
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 I-set Ig_3 LRR_4 ig Ig_2 LRR_5 V-set Ig_6 LRRCT V-set_CD47 Adeno_E3_CR1
Motif
Other DBs
NCBI-GeneID: 34912
NCBI-ProteinID: NP_001162986
FlyBase: FBgn0028370
UniProt: Q9V430
Position
2L
AA seq 1021 aa AA seqDB search
MAAGRAAATLEAPGPPSGQDIASDNSAQRRTLATKVRRKGPRPQRRLHPPLRPRLPLHLH
LLLWLLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGN
EIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLAL
YHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKL
DGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPSGIPPTCESPPR
LSGRAWDKLDVDDFACVPQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNRLIAN
LSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNASNLTILTADMQDAGIYTCAAENKAGKV
EASVTLAVSRRPPEAPWGVRIILLGAVAALLLVGGSSFAAICLCSLQRRRKLRLWNSVPP
VRRSESYEKIEMTARTRPDLGGGASCGGGSATGAGLFHDAEEQGYLRAAHTPLNDNDAGQ
AAAIVNPSAGSAQRRNGDYLHVSTHCDDEEEDQQLHHHPQQQPASQHHPHPNQQQHQQRK
GSQGHVVSASGANNSAPLEETDLHIPRLIDIGGTDSASSSISSQVDAAARLAGYAGHTWK
TTPIATTKINSPHSKPVTSAAPSSLNTQATPYAHYGNHPADEMATSVFCSEGQESDLFDS
NYPDLLDIAKYAVAQAQQEGRGQGYAQATTTPNGGLCTLPRKLKTSGKYFRNSSDSQSPL
LADNSSKYGSSTLGDGSFLNEAMGLGRRYSAESSYANYSSTATYTGGGQRANSFLNLVQS
GAHQGKLLPSHLGQKPSLPSSPVQHQRSLSSAATPLLDFSALASRAAGAANTSVAAYDYH
AAQLERFLEEYRNLQDQLCKMKETCDTIRKKETPLRVAIGQSAAQLADPVMYSAASHSPK
PPATSNLKTKTLLPGQPPDPPPYWLHRNAMLKRLNGDGSAGTNGSGGSPASPQPRQDIFK
S
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgggaagagcagccgctacgctggaggctccgggaccgcccagcggtcaggac
atagccagcgacaacagcgcccagcgccgcacgctggcgacgaaggtgcgtcgaaaaggg
ccacgcccccaacggcgcctgcacccgcccctgcgccctcgcctgccgctccatttgcac
ctgctactctggctgctgtgctgctgttctcagctgggccagctgagggccgagtgtcca
gcggtgtgcgagtgcaagtggaagagtggcaaggagtccgtcttgtgccttaacgccaac
ctaacccacatcccgcagccgctggacgcgggaactcagttgctggaccttagcggcaat
gagatccaactaatacccgacgatagcttcgcaaccgcccagttgctcaacctacagaag
gtgtacctggccaggtgtcacctccggcttatcgaacgccatgccttccgtaagctgatc
aatctagtggaactggatctaagccagaacctgctctcggcaataccctcattggcgctc
taccatgtctcagagctaagggagctccgactgagtggcaatcccatactgagagtgcca
gacgatgcatttggtcatgtcccacaattggtgaagctggagctgagcgactgccgcctt
tcgcacatcgctgtgcgagcatttgccgggctggagagcagtctggagtggctaaaactg
gatgggaatcggctgagcgaggtcaggagtggcacgatcacctcgctggcttcactgcat
ggtctggagttggcgcgcaatacctggaattgcagctgctccttgcgtcctttgagggcc
tggatgctgcagcagaatataccgagtggcataccgccaacatgtgagtctcctcctaga
ttgtccgggagggcttgggataagctcgatgtagatgactttgcgtgcgttccacaaatt
gtggccacggacaccacagcgcatggagtggagggcaggaacataaccatgagctgctac
gtggaaggagtaccccaaccggctgtcaagtggctgcttaaaaaccgactgatagccaat
ctcagtgctggcggggatggtgactccgattcggagcccaggacagcggcagcaactcag
ggtaggaagacctatgtggtcaacatgctgagaaatgcctcgaacctgaccattctcacg
gctgacatgcaggatgccgggatctatacgtgtgcggcggaaaataaggctggaaaagtg
gaggccagtgtgactctggcagtatcccgtagacccccggaagctccgtggggcgtaaga
attattctgctgggggcggtagccgctctgctcctcgtcggtggatcctcctttgcggcc
atttgcttgtgttccctacaaaggcgaagaaagctgcgtctctggaactctgtacctcct
gtgaggagaagcgagagctacgaaaagatcgagatgacggccagaacgagaccggatctg
ggaggaggggctagttgcggaggcggcagtgccacgggcgccggactctttcacgatgcc
gaggagcagggctatctgcgggcagctcatacgccactaaatgacaacgatgccgggcag
gcggcggccatcgtaaatccgagtgcaggaagtgcacagcgaagaaatggagactacctg
cacgtgtccacccactgcgatgatgaggaggaggaccaacagctgcatcaccacccacaa
cagcagcccgcgagccagcaccacccacatcccaatcagcagcagcatcagcaaaggaag
ggctcccagggccatgttgtctccgcatccggggcgaataattcagcaccgctggaggaa
acggatctgcacataccgcgcctcatcgacatcggcggcaccgattccgcatcgagttca
atctccagccaggtggacgctgctgcccgcttagcgggctatgccggacacacctggaag
accacacccattgccaccaccaagatcaattccccgcacagcaaaccagtgacctcggcg
gcaccatcgtctctgaatacacaggccacgccatacgcgcactatggaaaccatccggcg
gacgagatggccacctcggtgttctgcagcgaggggcaggagagcgacttgtttgatagc
aactatccggatctgctggatatagccaagtatgcagtggcccaggcgcaacaggaaggt
cggggtcagggttatgcccaagccacgaccactccaaatgggggcttgtgcacgctcccc
cgcaaactaaagaccagtggaaagtacttccgcaactcctcggatagccaatcacccctg
ctggcggataactccagtaaatatggtagtagcaccttgggcgatggaagcttccttaac
gaagcgatgggtctgggcaggagatattctgcggaatcgagttatgcaaactattcaagc
acggccacctacacgggcggtggccagcgggccaatagtttccttaacctcgtgcaaagt
ggcgcccaccaagggaaactgctgccgagtcatctgggccagaagcccagcctgccctca
agtccggtccagcatcagcgatctctgtcgagtgcggccacgccccttctggacttctca
gccctggcatcgagggccgccggagctgccaacacatcggtggccgcttatgattatcat
gccgcgcagctggagaggtttctggaagagtaccgcaacctgcaggatcagctgtgcaag
atgaaggagacctgcgatacgatccgtaaaaaggagactcctttgcgagtggccattgga
cagtcggctgcgcagttggcggatcccgtaatgtacagtgcagcctcgcacagtccaaaa
ccgccggcgaccagcaatctgaagacaaagaccctactcccaggacaaccacccgatcca
ccaccatactggttgcaccggaacgccatgttgaagcggttaaatggtgatggaagtgct
ggtactaatggttcaggtggatctcccgcctctccacagcccagacaggatattttcaag
agctaa

DBGET integrated database retrieval system