KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4225
Entry
Dmel_CG4225       CDS       T00030                                 

Gene name
Hmt-1
Definition
(RefSeq) heavy metal tolerance factor 1
  KO
K05661  ATP-binding cassette, subfamily B (MDR/TAP), member 6
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Dmel_CG4225 (Hmt-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG4225 (Hmt-1)
Transporters [BR:dme02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB6, 7 subgroups
    Dmel_CG4225 (Hmt-1)
Motif
Pfam: MTABC_N ABC_membrane ABC_tran SMC_N AAA_16 RsgA_GTPase AAA_22 AAA_29 AAA_23 DUF2214 MMR_HSR1 AAA_30 AAA_21 APS_kinase AAA AAA_24 AAA_10 Guanylate_kin ATP-synt_ab
Other DBs
NCBI-GeneID: 41925
NCBI-ProteinID: NP_650503
FlyBase: FBgn0038376
UniProt: Q9VF20
Position
3R
AA seq 866 aa
MLYCPPNVTLSEVWTQHGISHCFMDTVGPAVYGGFLLLFGSIQLLMYRKYATRITDPTQI
SKSRLFAMQLFLLLLLPVLALLRFLMNARIYPDSAVYGYMIFSTCVVCFSYPFSICLILK
ERYYQLPSMPTRGHGLVLLLFWTLAFINESLAFINLRHEDWWFHLKTNKDQIEMGLFVTR
FLCSLLIFVLGLKAPGIMAPYNPHQRLDNDTANESQGNVQTGSAFRNGWRKLRTVFPYLW
PKKNIALQIAVIVCIILLLAGRVIKLFLPIYRKKLVDSLTIAPIVFRWDFVLIYVALSFL
QGGGTGSMGLFNNLRTFLWIRVQQYTTREIEIELFRHLHQLSLRWHLQRKTGEVLRVMDR
GTDSINNLLNYIVFSIAPTILDLLVAVAYFVYAFNWWFGLIVFLTMFLYIASTIAITEWR
TKYQRRMNLADNEQRARSVDSLLNFETVKYYGAEHYEVDCYREAILKYQKEEFLSMLTLN
MLNTAQNIILCLGLLAGSLLCVYLVVHHQTLTVGDFVLFSTYLMELYMPLNWFGTYYRAI
QKNFVDMENMFDLLKEEEEIVDAPGCSPLLTAGGGIEFSNVTFGYSPEKIVLRNVSFTVP
AGKTVAIVGPSGAGKSTIMRLLFRFYDVQTGAILIDGQNIKLVQQQSLRKAIGVVPQDTV
LFNNTIFYNIEYAKLGASDEAVYEAARAADIHERILGFPEKYETKVGERGLRLSGGEKQR
VAIARTLLKAPIIVLLDEATSALDTHTERNIQAALARVCANRTTIIVAHRLSTIIHADEI
LVLQQGSIAERGRHEELVLREDGIYADMWQQQLKNLDAEQSGGSDNGDASAESGSEKRRA
GGAGGPSGTGTGGAHFRAGHAHGGAR
NT seq 2601 nt   +upstreamnt  +downstreamnt
atgctgtactgcccgcccaacgtgaccctcagcgaggtgtggacgcagcatggcatctcg
cattgcttcatggacaccgtgggaccggcggtatacggtggattccttctgctcttcggc
agcattcagttgctgatgtaccggaagtatgccaccaggattacggatcccacgcaaatc
tccaagtcacgactgttcgcgatgcaactctttctgttgctcctgctcccggttttggct
ctattgcggtttctgatgaatgcacgtatttatccagatagtgcggtgtacggctatatg
atcttctccacttgcgttgtgtgcttctcctacccgttcagcatctgtttgatactcaag
gagcgctactaccagctgccctcaatgcccacccgaggacatggacttgttctattgcta
ttctggacgttggctttcattaacgagtcgctggccttcataaatttgcgccacgaggac
tggtggttccacctaaaaacgaacaaggatcaaattgagatgggcttgtttgtcacccgg
ttcctgtgctccctgctcatcttcgttttgggtctgaaagctcctggcatcatggccccg
tacaatccacatcagcggctggacaatgataccgccaacgaatcgcagggaaacgtgcag
acaggatctgctttcaggaacggatggcgcaagctgcgcaccgtctttccgtacctctgg
cctaaaaagaatattgctctgcagatagccgtcatcgtttgcattatactgctgcttgcc
ggtcgagtcataaagctgtttttgccgatttatcgcaagaagttggttgacagtcttacc
attgcaccgatcgtctttcgctgggactttgtgctgatctatgtggcattgtccttcctc
cagggtggcggcactggtagcatgggattatttaataaccttcgcaccttcctctggata
cgggttcaacagtacacgacccgggagatcgagattgagctgttccggcatctgcaccag
ctttcgcttagatggcacttgcaacgcaaaacgggagaggtgttgcgtgtcatggatcgc
ggcacggactcgatcaacaacctcctcaactatattgtcttctcgatcgcaccaaccatt
ctcgatctactcgttgccgtggcatactttgtttacgccttcaattggtggtttggccta
atcgtcttcctcaccatgttcctgtatatagcctctaccattgcaatcactgaatggaga
accaagtaccagaggagaatgaacctggcggacaatgagcagcgagctcgcagcgtggac
tcccttctcaatttcgaaacagtcaagtactacggagcggagcactacgaggtggattgc
tacagggaggccattctcaagtaccaaaaggaagagttcctctcaatgctgacactcaac
atgctgaacacagcccagaatattattttgtgcttgggcctactggccggatcgctgctc
tgtgtatacttggtagttcaccatcaaaccctcaccgtgggcgattttgtgctcttctcc
acctatctgatggaattgtacatgccactgaattggttcggcacctattaccgagccata
cagaagaacttcgtggacatggagaacatgttcgatctgctgaaagaggaggaagagatt
gtggatgccccaggctgttcgccccttctaactgccggcggtggcattgagttctcaaac
gtgacctttggctattcaccggagaagatagtgctgcgcaatgtgagcttcacagttccg
gccggtaagacggtagcgattgttggaccctctggagccggtaagagcaccatcatgcgg
ctgcttttccgcttttacgatgtgcagactggtgctatcctgattgacggacaaaacatc
aagcttgtgcagcagcagagtctgcgaaaggccattggagtggtgccccaggatacggtt
ctctttaacaacaccatcttctacaacattgaatatgccaagttgggcgcttcggacgaa
gctgtctatgaggctgctcgcgccgccgacattcacgaaaggattctcggctttccggag
aaatatgagacaaaggtgggcgaacgaggtctgcggctcagtggaggtgaaaagcaacgc
gtagccatcgccagaacgcttcttaaggcgcccattattgtgctcctggatgaagccacc
tcagctttggacacccacacagaacgcaatattcaggctgctttggccagggtgtgcgca
aatcgtaccaccatcattgttgcccatcgtctttccaccatcatccatgcggacgagatt
ctggtcctgcagcagggaagcatagcggagcgtgggcgacacgaagagcttgtgctgcgc
gaagatggcatctacgcggacatgtggcaacagcaactcaagaatctagatgcagaacag
agtggtggttctgataacggagacgctagtgcagaatcgggatcggagaaacgcagggca
ggaggagcaggaggaccaagtggtactggaacgggtggtgcccacttcagggcaggacat
gctcatgggggagcacgctag

DBGET integrated database retrieval system