KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5557
Entry
Dmel_CG5557       CDS       T00030                                 

Gene name
sqz
Definition
(RefSeq) squeeze
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-met Actin_micro
Other DBs
NCBI-GeneID: 42300
NCBI-ProteinID: NP_524403
FlyBase: FBgn0010768
UniProt: Q9VDZ3 U3PU53
Position
3R
AA seq 535 aa
MAELPTAPNGVPSGDYLHRSIDQLRSLGHLTTAQLVHDYKPFNISEFRQNVAERLDYSLK
NGLVQHQQQMVMEQQPHPDQQQQQHLHHPQQQQHPPQLKVSYSAPNSPPTPHEQQEQKYD
PNRSPPRQQMSSASGSGSNGSSPEEESRRGDGDQAKPYKCGSCSKSFANSSYLSQHTRIH
LGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAGCPKAFSQLSNLQSHSRCHQT
DKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNLCGKSYTQETYLQKHLQKHAEK
AEKQQHRHTAQVAAHQQHVPASGIGLNLQRQAMNDVNAAYWAKMGADSAAASLAEAIQQQ
LPQAGGQPYGNFASLQQQHQQQQQELLHHQRLADTPGHSHSPHEEAAGEDLVLRQSTPQH
HLQQQQQQQQQQQAQQQQQAQHQPSPGPGNSAFTPLSATVAPPPHLQQHRGPPGSAAAYL
YQQNAAAAAAAFPTQLISLHQIRNYAHQPGAAGLIAGDHLALGLSAVNAAKEKAQ
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggccgaactgccgacggcgccgaacggcgtccccagcggcgattatctgcaccgctcc
atcgatcagctgcgttcgctgggtcatctgaccaccgcccaattggttcacgactacaag
cccttcaacattagcgaattccggcagaatgtcgctgagcgactggactactcgctgaag
aacggcctggtgcagcaccaacagcaaatggtcatggagcagcagccacatcccgatcag
cagcagcagcagcatctgcatcacccgcaacagcagcagcacccgccgcagctgaaggtc
agctacagtgcgcccaactcgccgcccactccacacgagcagcaggaacagaagtacgac
ccgaatcgatcgccgccgcgtcagcagatgagcagcgctagcggcagtggcagcaacggc
tcctcgcctgaggaggaaagccgacggggagacggtgatcaggccaagccctacaagtgt
ggctcgtgcagcaagtcctttgccaactcctcgtacctgtcgcagcacacgcgtatccac
ctggggatcaagccgtaccgctgcgagatatgtcagcgcaagttcacgcaattgtcgcat
ctccagcagcacatccgtacgcacacgggtgacaaaccgtacaaatgccggcacgccggc
tgcccgaaggccttctcgcagctatccaatctgcagtcacactcgcgttgtcatcagacg
gacaagccgttcaagtgcaactcctgctacaagtgcttcagcgacgagatgaccctgctg
gagcacattcccaagcacaaggactccaagcacctgaagacgcacatctgcaatttgtgt
ggcaaatcgtacacgcaagagacctaccttcagaaacatctgcagaagcacgcagagaag
gcggagaagcagcagcatcgccacacggcccaggtggctgcccaccagcagcacgtaccg
gcgagcggcatcggcttgaatttgcagcgccaggccatgaacgatgtgaatgccgcatat
tgggccaaaatgggcgcagacagtgcggcggcttcgctggcggaagccattcagcagcag
ttgccgcaggccggcggtcagccgtatggcaactttgcatccctgcagcagcagcatcag
caacagcagcaggaactgctgcatcatcagcgattggcagacacgccggggcattcgcat
agtcctcacgaggaggccgcgggcgaggatctcgtcctgcgccagtcaacaccacaacat
caccttcagcaacaacagcagcagcagcaacagcagcaggcccagcagcaacaacaagcg
cagcaccagccatcgcctggaccgggaaactcggccttcactccactgtcggcgacagtg
gctccaccgccacatcttcaacagcatcgcggtccgccaggatccgccgctgcctatctg
tatcagcagaatgcggcggcagcagcagcggcttttcccacacagctcatctcgcttcac
cagatccgaaactatgcccatcagccaggagcggcgggtctcatcgctggcgatcatctc
gccttgggcctgagcgctgttaatgccgccaaagaaaaggcgcaatag

DBGET integrated database retrieval system