KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6720
Entry
Dmel_CG6720       CDS       T00030                                 

Gene name
Ubc2
Definition
(RefSeq) ubiquitin conjugating enzyme 2, isoform C
  KO
K20217  ubiquitin-conjugating enzyme E2 E [EC:2.3.2.23]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG6720 (Ubc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG6720 (Ubc2)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     Dmel_CG6720 (Ubc2)
Ubiquitin system [BR:dme04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   Dmel_CG6720 (Ubc2)
SSDB
Motif
Pfam: UQ_con Prok-E2_B RWD
Other DBs
NCBI-GeneID: 34487
NCBI-ProteinID: NP_001260362
FlyBase: FBgn0015320
UniProt: P52485 Q541C3
Position
2L
AA seq 232 aa
MSSTPAAGSAAEVATSSATSNAPSAPSTTASNVSNTSQPTTAGTPQARGGRGSNANGGAS
GSNAGGGDEPRKEAKTTPRISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVS
TILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSP
ALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYAT
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtcttcaaccccagcagcgggcagtgccgccgaggtggccacctccagtgccacctca
aatgcgcccagtgcacccagcacaacggccagcaacgtgagcaataccagccagccgacg
actgccggaactccgcaggcacgtggcggcaggggcagcaacgccaacggtggtgcctcc
gggagcaatgccggtggcggagatgagccgcgaaaggaagccaaaacaacgcccaggata
tccagggcgctgggcacctcggccaagcgcatacagaaggagctggctgagatcacactg
gacccaccgcccaactgcagtgccgggcccaagggcgacaacctgtacgagtgggtatcc
accatactgggaccacccggatccgtctacgagggcggcgtcttcttcctcgacatacac
ttctcgccggagtatcccttcaagccacccaaagtcacgttccgcacgcgcatctatcac
tgcaacatcaacagccagggcgtcatttgcctggacatactcaaggacaactggtcgccg
gcgctgaccatatcaaaggtcttgctgtcaatttgctccctgctcacagactgtaatcca
gccgatccgctggtgggcagcattgccacgcaatatttgcagaatcgtgaggagcacgat
cgaattgcgcgtctctggacaaaaaggtacgcaacatga

DBGET integrated database retrieval system