KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7357
Entry
Dmel_CG7357       CDS       T00030                                 

Gene name
Odj
Definition
(RefSeq) oddjob
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: zf-AD zf-C2H2_4 zf-C2H2 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-met ADK_lid OSTMP1 zf-piccolo
Other DBs
NCBI-GeneID: 42145
NCBI-ProteinID: NP_650661
FlyBase: FBgn0038551
UniProt: Q9VEF0
Position
3R
AA seq 430 aa
MSTECRICGERIFTPHPKNIFEKRNHRIRMAIEQITGLEIVLENMLPQHICACCLLDLTQ
AVAFRQRCLETHANLHQRISSKAGVASKGSPEVSPVLSDPLLKREVLDDTVDTEDDKELL
DDDKDLMDDDKDFLEDEKPILRYPPAKKIRIEDQNFPNRQSPRVRVKRLRVPVVEKADSP
PPPPREHVRKPRKRRPKPKVDRSIKRYVCDQCGWSFNDHSNMKDHKLRHFEEKFSCDECG
RKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKR
FNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRHYSTKYHRKRVNLLVNGPKEE
FQSEVDPAEFPGYMEEGQAEMEDNQAELDVMLDNIDEEQYEDHEVLQDEDANFEDFEYEE
AIPDGEELYT
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgagcaccgagtgtcggatctgcggcgagcgcatcttcacgccgcacccaaagaacatc
ttcgagaagcgcaatcatcgcattcggatggccatcgagcaaatcacgggcttagagatc
gttttagagaatatgctgccccagcacatatgcgcttgttgtctcctggacctgacccaa
gccgtagccttcaggcagcgatgcctggagacgcacgcaaatctccaccagaggatctcc
tcgaaggcgggtgtcgcctcaaaaggctccccggaggtttcgccagtgcttagtgatccg
ctgctgaaacgggaggtgctggatgatacagtagacaccgaggacgataaggagctactg
gacgatgataaggatttaatggatgatgataaggatttcttggaggacgaaaagccgatt
ttaagatatcctccggccaaaaaaatccggatcgaggaccaaaatttcccgaacagacag
tccccacgagtcagggtcaagcggcttcgtgtgcctgtggtcgagaaggcagatagtcca
ccgccacctccgcgggagcacgtccgaaagcccagaaagcggcgaccaaaacccaaggtc
gatcgctcgataaagcgatacgtgtgcgaccagtgcggttggtcgttcaacgatcacagc
aacatgaaggatcacaagctgcggcacttcgaggagaagttttcatgcgacgagtgcggt
cgcaagttctacaccatgccactgctccgattgcacattcgagtccatcacaagggcgag
aaaccgtacgtctgcaagttctgcggtatgggattcgccaatagtcccagccgctgtcgt
catgaacgtcaaatgcatgccaacgagctggtgcacccgtgcaaaatatgcggcaaacga
ttcaacagcgagaagggacggctgaagcacgaggaggggcacaagagtgaccaaccggat
gtccatatctgcctcacatgcaacaaggagttcaaggaggcgcagtttttgcatcggcac
tactccacaaagtatcaccgcaagcgggtcaacttgctggttaatggtccaaaagaggaa
ttccagtctgaagtcgatccggcggagtttccgggatatatggaagaggggcaggcagaa
atggaggacaaccaggctgaactggacgtaatgttagataacattgacgaggaacaatat
gaggaccacgaggtacttcaggatgaggacgcaaattttgaggacttcgagtacgaggaa
gccattcccgatggagaggagctgtacacctaa

DBGET integrated database retrieval system