KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7586
Entry
Dmel_CG7586       CDS       T00030                                 

Gene name
Mcr
Definition
(RefSeq) macroglobulin complement-related
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: TED_complement A2M A2M_recep A2M_BRD MG2 MG3 Ldl_recept_a MG4
Other DBs
NCBI-GeneID: 44071
NCBI-ProteinID: NP_524688
FlyBase: FBgn0267488
UniProt: Q9VLT3
Position
2L
AA seq 1760 aa
MMWHLLRALLVVAAVLDALQPAVGQNDNYYNPNQNQQNPQQPLLPNQQWGNNPQTNQYSN
NNQNFGQTNPSDRPPYRTDSGSYNDIAGQDDYNKRVGGGYQDNEEPSLTRGKSSYNIKAT
FLESLHSREPTYFIVASRMVRPGLIYQVSVSILQAQYPITVHASIACDGVQISGDSKDVK
EGIPETLLMRIPPTSVTGSYKLRVEGFYQNVFGGLAFLNETRLDFSQRSMTIFVQTDKPL
YMQGETVRFRTIPITTELKGFDNPVDVYMLDPNRHILKRWLSRQSNLGSVSLEYKLSDQP
TFGEWTIRVIAQGQQEESHFTVEEYYQTRFEVNVTMPAYFFTTDPFIYGRVMANFTSGLP
VRGNLTIKATIRPIGYFSNQVLNEKYRLGRSPLEQTNLYNERWRYNNPNQNPQVQYNVPG
QLPQDGADLSQDILYRNQYVVERHYQFDEEWPFWVRKPEYQDSSYEAWSGTYRKTLPYLR
YFNGTFDFKWPLRELELLVPNLANSEVLITATVGEKFYDEIISGYSVARVYNSSLRVVFL
GDSPQVFKPAMPFTTYLAVEYHDGSPIDPNLLRQGLMEVSGFVESRNGGRRDWPAQRLPM
SQQSDGIWEVKIDIRNDLNLDDRPQARDFLNGVQNMRLQANFVDPRGERIQTELLLVSHY
SPRNQHIKVTTSTEKPVVGEYIIFHIRTNFYLEEFNYLIMSKGVILVNDRETITEGIKTI
AVVLSSEMAPVATIVVWKINQQGQVVADSLTFPVNGISRNNFTVYINNRKARTGEKVEVA
IFGEPGSYVGLSGIDSAFYTMQAGNELTYAKIITKMSNFDEQTNGTYKHIWYSHEGNPDE
LVYFPASSFGVDANRTFEYSGLIVFTDGYVPRRQDTCNRTLGFGECLSGRCYRLEKQCDG
LFDCDDGTDEINCHARNDTELLNYRKYRFNRVLRHYENVWLWKDVNIGPHGRYIFNVEVP
DRPAYWMVSAFSVSPSKGFGMMNKALEYVGVQPFFINVEMPEACRQGEQVGIRVTVFNYM
ITPIEAIVVLHDSPDYKFVHVEEDGIVRSYNPRTSFGEHQFFIYLEAQGTTVVYVPVVPQ
RLGNVDVTLHVATLLGTDTITRTLHVESDGLPQYRHQSVLLDLSNRAYVLEYMHVNVTQT
PEIPYQVDRYFVYGSNKARISVVGDVVGPIFPTMPVNASSLLSLPMESGEQNAFSFAANL
YTIMYMRLINQRNKTLEKNAFYHMNIGYQRQLSFMRPDGSFSLFRSDWNNSDSSVWLTSY
CLRVFQEASFYEWENFIWIDATIIEKNMRWLLQHQTPQGSFFEVTWLPDRKMNRTNFDKN
ITLTSHVLITLATVKDISGTLGSRVALATQRALAYIERNMDFLRHQAQPFDVAITAYALQ
LCNSPIAEEVFAILRRQARTIGDFMYWGNQEIPQPPRKLENQKWFSLPRLPYEYDSLNIE
TTAYALLVYVARREFFVDPIVRWLNSQRLNDGGWASTQDTSAALKALVEYTVRSRLREVS
SLTVEIEASSQGGKTQTLYIDDTNLAKLQSIEIPDAWGTIKVQAKGAGYAILQMHVQYNV
DIEKFQTKPPVPAFGLHTKAIFHGRNQSHISYVACQNWINQNESERSGMAVLDVAIPTGY
WIQQQKLDTYVLSNRVRNLRRARYLERKIVFYFDYLDHEDICVNFTIERWYPVANMSRYL
PVRIYDYYAPERFNESIFDALPTYLLNICEVCGSSQCPYCSIYNMGWRASMSMSLLFFSV
FIYLLRSRTHLVLNMMQLLT
NT seq 5283 nt   +upstreamnt  +downstreamnt
atgatgtggcacttgctgcgcgccctgctcgtggtagccgccgtcttggatgcactgcaa
ccggcggtcggacaaaacgacaactactacaaccccaaccagaaccagcagaatccccag
cagccgctactgcccaaccagcagtggggtaacaatccacagacgaatcagtatagcaac
aacaaccaaaactttggccaaacgaatcccagtgatcgcccgccgtacaggaccgattcg
gggagctacaacgatattgccgggcaagatgactataataaacgagtgggaggaggctat
caggacaacgaggagccgagtctgactcgtggaaagtcgtcctataacatcaaggccacc
ttcctggaatcgctgcattccagggagcccacttacttcattgtggcatctcgaatggtc
agacctggtctaatctatcaggtgtccgtatccattcttcaagctcagtacccgataacc
gttcatgccagcatcgcgtgcgatggtgtccaaatcagcggagactctaaggatgtcaag
gagggcataccggagacgttgctcatgaggatcccaccaactagtgtgactggaagctat
aagcttcgagtggaaggtttctaccagaacgttttcggtggcctcgccttcctgaacgaa
acaagactagacttctcacagcgctccatgacgatatttgtgcagaccgataagcctctt
tatatgcaaggggaaactgtgcgatttaggaccattccgatcaccaccgaactgaaggga
tttgacaatcccgtcgatgtgtacatgctggatccaaacaggcatattcttaaacgttgg
ctatcgcgtcaatcaaacttgggttccgtttcgctggagtacaaactttcggatcagccc
acttttggagaatggactatccgtgtaatagctcagggacagcaagaggagagtcacttc
accgtggaggaatactatcagacccgattcgaagtgaatgttaccatgcctgcgtacttc
ttcacaacggatccgtttatctacggaagggtgatggctaactttaccagtggcctacca
gttagaggcaatctcacaatcaaggccacgatccgcccaattggatacttcagcaaccaa
gttctaaatgagaagtatcgcctgggtcgttcacctttggagcaaactaacctatacaat
gagcgatggcgctacaataatcccaaccagaatccgcaagtgcagtataatgtgcctgga
caactgccacaggatggagcagatctttcacaggatattttgtacaggaatcaatatgtg
gtcgagcgacactatcagttcgacgaggagtggccattctgggttaggaaacccgagtat
caggacagcagctacgaggcgtggagtggaacttatcgaaagaccctgccctacttgcgc
tacttcaatggtacctttgacttcaagtggccattgagggagctagagcttctggtgccc
aatctggccaactctgaggtgctgatcacggccactgttggtgaaaagttctacgatgag
atcatcagtggttactccgtggccagggtgtataattccagtctgagggtggtattcctt
ggcgattcgccgcaggtcttcaagcccgccatgccatttaccacatatctggctgttgag
taccatgatggttcgccaattgatccaaacctattacgccagggtttaatggaagtctct
ggtttcgtggagagccgcaatggtggcaggagggactggcccgcccagcgattgcctatg
tcgcagcaaagcgatggcatttgggaggtgaagattgacatcaggaatgatctgaacctg
gacgatcgcccacaagcaagagacttcttgaacggcgttcagaacatgcgcttgcaggcg
aactttgtggatccgcgtggtgaacgcattcaaacggagctccttttggtgtctcactat
tcgcccagaaatcagcacattaaggtcaccaccagcacagagaaaccagtggttggggag
tatatcatcttccacatccgcacgaatttctacctcgaagagttcaactatctcattatg
tcaaagggtgttatcctggtgaatgaccgcgaaaccattacagagggcattaaaaccatt
gctgttgttctgagttccgaaatggcacctgtggctacgattgtagtgtggaagattaac
cagcagggacaggttgtggccgattcccttacgttcccagttaatggcatctcccggaat
aactttaccgtatatatcaacaatcgcaaagcgagaaccggagaaaaagtggaggtggct
atctttggagaaccgggctcgtatgttggtctctctggcatcgacagtgcattctacaca
atgcaagccggcaacgagctcacttacgccaagatcatcactaagatgtccaacttcgac
gagcagaccaatggaacgtataagcacatttggtactctcacgaaggcaatcccgatgag
ctggtgtacttccccgcctcgtcctttggcgtcgatgcaaatcgcacttttgagtacagt
ggactgatcgtatttacggatggttatgtacccagaaggcaggacacctgcaatcgtact
ttgggtttcggagagtgtttgagtggacgttgttatcgcctggagaagcagtgcgatggt
ttgtttgattgtgatgatggaacggatgagatcaattgccatgcgcgtaatgacacagag
ctgttgaactacagaaagtaccgatttaatcgcgtgcttcgccattacgaaaatgtgtgg
ctatggaaggatgtgaacattggaccacatggtcgatacatttttaatgtggaggtgcct
gatcgccccgcctattggatggtcagtgcgtttagtgtgagtccatcgaaaggctttgga
atgatgaacaaggccttggagtacgttggtgtccaaccattcttcataaacgtggaaatg
ccggaagcttgccgacaaggcgagcaggtgggcatccgtgtcactgttttcaactatatg
ataactcccatcgaggcgattgtcgtgctgcacgacagtccggactacaagtttgtgcac
gtggaggaggatggcatcgtcagatcgtataaccccagaactagctttggtgaacatcaa
tttttcatctacttggaggctcaaggcacgacggtggtttacgtgcccgttgtacctcag
cgtctaggcaatgtggatgtgaccctacacgtggccactttacttggaacagataccata
acgcgaacactgcatgtagaatcggatggtctgccacagtatcgtcatcaatccgtgcta
ctggatctctctaaccgcgcctatgtcctagaatacatgcatgttaatgtaactcaaacg
ccagaaattccataccaagtggatcgttactttgtgtacggctcaaataaggctaggata
tccgtagtgggtgatgtggttggtcccattttccccaccatgcccgtaaatgccagctcc
ctgctttccttgcccatggagtcgggcgaacagaatgctttcagcttcgccgccaatctc
tacacgattatgtacatgcgattaattaatcaacgcaacaaaacgctggagaagaatgcc
ttttaccacatgaacattggctatcagcggcagttgagttttatgcggcccgatggcagc
ttctcactgttccgttccgattggaacaactccgattcgtccgtctggttgactagctac
tgcttaagggtgttccaagaggccagcttctacgaatgggagaacttcatctggatcgat
gccacaattattgaaaagaacatgagatggcttctgcaacaccagacgccacagggatcc
ttcttcgaggtcacgtggctgccggataggaagatgaatcgcaccaactttgacaagaac
atcacgctaacgtcccatgtactcataaccttggccaccgtaaaggatatctctggcact
ctgggctctcgagttgctttggccacgcagcgtgccttggcgtatatagaacgaaatatg
gacttccttagacaccaggcgcaaccttttgatgtggccattacagcgtacgccctgcag
ctttgtaactctccgattgccgaggaagtattcgccatcctgcgtcgccaggccaggact
ataggcgattttatgtactggggtaaccaggaaatacctcaacctccacgcaagctggag
aatcaaaagtggttctcgctgccccgtctgccatacgaatatgattcgctgaatatagag
acaaccgcctacgcgctattggtttatgtggcgcgccgtgagttcttcgtggatcccatt
gtgcgatggttgaactcgcagcgcttaaacgacggcggatgggcatccacccaggatacc
agtgctgccctcaaggctcttgtggagtacacagtccgatctaggctgcgcgaggtttcc
tcgttgaccgtggagatcgaggcctcttcgcagggcggcaaaacacaaacgctttacatt
gatgacacgaatctggcgaaattgcagagtatcgagattccagatgcctggggcaccatc
aaggttcaggccaagggtgctggctatgccatcctgcagatgcacgtgcagtacaatgtg
gacattgagaagttccagaccaagccgccagtgccagccttcggacttcataccaaggca
atcttccacggcaggaatcagtcgcatatctcctatgtggcttgtcaaaattggataaac
caaaacgagtcggagcgctcaggcatggcggtcttggatgtggccataccgactggctat
tggatacagcagcaaaaactggatacctatgtgctcagcaaccgtgtgagaaatctgaga
agagctcgttatctagaacgcaagattgtcttttacttcgattatcttgatcatgaggat
atctgtgtaaacttcaccattgagcgttggtatccagtggccaatatgtctcgctatctg
ccggtgcgcatttacgactactatgcaccggaacgattcaacgaatccatattcgatgcc
ctgcccacatatctgctgaacatttgtgaggtgtgcggcagctctcagtgtccgtactgc
tccatctacaacatgggctggcgcgcctccatgtccatgtccctgctcttcttcagcgta
ttcatatacctactgcgaagtcgcacgcacctggtcctaaacatgatgcaactgctcaca
tag

DBGET integrated database retrieval system