KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8241Help
Entry
Dmel_CG8241       CDS       T00030                                 

Gene name
pea
Definition
(RefSeq) peanuts
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Dmel_CG8241 (pea)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dme03041]
    Dmel_CG8241 (pea)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Dmel_CG8241 (pea)
Spliceosome [BR:dme03041]
 Complex C
  Other components
   Step II factors
    Dmel_CG8241 (pea)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 T2SSE AAA_19 DUF2075 Flavi_DEAD AAA_30 AAA PhoH
Motif
Other DBs
NCBI-GeneID: 36561
NCBI-ProteinID: NP_610928
FlyBase: FBgn0086895
UniProt: A1Z9L3
Position
2R
AA seq 1242 aa AA seqDB search
MDELQKLEYLSLVSKICTELDNHLGINDKDLAEFIIDLENKNRTYDTFRKALLDNGAEFP
DSLVQNLQRIINLMRPSRPGGASQEKTVGDKKEDKKSQLLKMFPGLALPNDTYSKKEESD
DDEKVKAKPEKHSETHKKTDMSDVDAAMMELEALAPGEGATLVRPHKEVSSRDRHKRRSR
DRDTKRRSRSREDRHSDRRRSRSRDKERRRRSRSRDNRRRSRSREDRDRDRDRRHKSSSS
RDHHERRRRSRSRSTERRDRRDRSRDCSEKMPPPSAAMTDDPEAGKIYSGKIANIVPFGC
FVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVKVMSITGQKVSLSMKEVDQ
DSGKDLNPLSHAPEDDESLRDRNPDGPFSSSTSMLNLQGNGMEGDEHESRKRVTRISSPE
RWEIKQMISSGVLDRSEMPDFDEETGLLPKDEDDEADIEIEIVEEEPPFLSGHGRALHDL
SPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQREQEIEAMPTSLNKNWIDPLPEDESR
SLAANMRGMAAAPPEVPEWKKHVIGGKKSSFGKKTDLTLVEQRQSLPIYKLRDDLIKAVT
DNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEYGCRLG
QEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFG
LLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDA
SLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSE
MQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPI
SQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGIND
LLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVAL
QCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSN
AWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKD
PQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPS
FFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVRRRRN
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atggacgagctgcagaagttggagtacctttcgctggtctcgaagatttgcactgagcta
gacaaccacttgggcatcaacgacaaggacctggccgagtttatcatcgatttagaaaac
aaaaatcgcacatatgacacatttcgcaaggctttgctggataatggcgccgaattccca
gactccctggtccagaacctgcagcgcatcattaatcttatgcgccccagcagacctggc
ggcgctagccaggagaaaactgtcggcgacaagaaggaagacaagaaatcgcaacttttg
aaaatgtttcccggcctcgctttgcccaatgacacctacagcaaaaaggaggagagcgat
gacgatgagaaggtgaaggcgaaaccggagaagcattccgaaacgcacaaaaaaaccgat
atgagcgatgtggatgcagctatgatggagctggaagcgctggcccctggcgagggtgcc
acattggtaagaccacacaaagaagtcagttccagggaccgccacaagcgccgaagtagg
gatcgagacacaaaaagaagaagtaggtcgcgggaggataggcactctgatcgccgcaga
agcagatcgcgtgacaaggaacgccgtcgtcgcagcagatcccgagacaatcgccgcaga
agcaggtctcgcgaggatcgcgatcgtgacagagatcgacgccacaagagttccagctca
agagatcaccacgaacgccgaagacgaagccgatctcgttccacagaacggagagatagg
agagatcgttcgagggactgcagtgaaaagatgcccccaccatctgccgccatgaccgat
gatccggaggcgggcaagatctattccggcaagatagctaatattgtaccctttggttgc
ttcgtacagctttttggactgcggaaacgctgggaaggcttagtacacatctcacaacta
agagcagaaggacgcgtgacagatgtaacggaggtagtcactcggaatcagactgttaaa
gtgaaagtaatgtcaataactggtcaaaaagtgtccttgtcgatgaaagaggtggatcag
gactctggaaaggatcttaatccactgtcacacgcgccagaagacgatgagtctctacga
gatcgaaatccagatggcccctttagcagcagcacatcgatgctgaatttgcaaggcaat
ggaatggaaggtgacgagcacgagtccaggaaacgtgtgactaggatctccagccctgag
cgctgggaaatcaagcaaatgattagttccggtgtgttggacagaagtgagatgcctgat
ttcgacgaggaaacaggcttattgccgaaagacgaagacgacgaagctgatatcgagatt
gagattgtggaagaggagccacccttcctctccgggcatggtagagccttacatgatctg
tctccagtgagaattgtaaagaatcccgatggctcactggctcaagctgccatgatgcag
tcggctttgtctaaggagcgtcgcgagcagaagatgttgcagcgtgaacaagagatagaa
gctatgccaacgagcctcaataagaactggatagacccactgccggaggatgagagccgc
agcctggcggccaacatgcgaggaatggctgctgctcctcctgaagttccagaatggaaa
aagcatgtcattggcggcaagaaatcctccttcggtaagaagactgatctgacgctagtg
gagcagcgacagtcgttgcccatatacaaactgcgagatgatctgatcaaagcggtcacg
gacaaccagatccttattgtgattggagaaactggttcgggaaaaaccacacagatcact
cagtatttaggcgaatgtggatttactgctagaggaaagattggctgcacccaacccaga
agagtggctgccatgtcggtggccaagcgtgtggcggaggagtacggttgcaggttaggc
caggaggttggctacaccattcgtttcgaggattgcaccagtccggaaaccataattaag
tacatgactgacggtatgttgctccgtgagtgcctaatggaggcggagctaaaaagttat
tcggtcattatgttggatgaggctcacgaacggacaatccatactgatgttctcttcggc
ctgctgaagacagccgtgcaaaagcgaccagaactgaagctaattgtcacatcagccacc
ttggacgcggtgaagttctcgcagtacttcttcaaggcgccaatcttcacaattcccgga
agaaccttccccgtggaggttttatataccaaggaaccagagacggactatttggatgct
tctctgattacagtgatgcaaatccatttgcgagaacctcctggtgacattctgctcttc
cttacgggtcaggaagaaatcgacacggcttgtgaaattttgtacgagcgaatgaagagt
ttgggaccggatgtccccgagctgattatcctgccggtgtactccgcgttgccatccgaa
atgcagacccgtatatttgatcctgcgcccgctggcagccgaaaggttgttatagccacc
aatattgctgaaacttcacttacaatcgatggcatattctatgtggtagatcctggtttc
gtgaaacagaaggtgtacaactcgaaaacgggcatggactcgctggtggtcactcccatt
tcacaagcggcagcaaagcaaagagcgggaagagccggacgtacaggcccaggaaaaacg
taccgtctctatacggaacgtgcgtatcgagatgaaatgctgcccacgccggtgccagaa
atccagcgaaccaatttggccacaacagtactccaactaaagacaatgggaattaacgat
ctgctgcactttgatttcatggacgccccgcctgtggaatcgctggtgatggcgctcgag
caactacattccctatcagcattggatgacgaaggcctgcttactcgactgggcagacgc
atggcggagtttcccctcgagccgaatctatccaagatgcttataatgtccgtcgctctg
cagtgttccgatgagattttgactattgtttcgatgctcagtgtgcagaacgtgttttac
aggccaaaggacaagcaggcactggcggatcagaaaaaggccaaattcaatcaagcggaa
ggtgaccatctgacgctgctggccgtttacaacagttggaagaacaacaaattctcaaat
gcctggtgctacgaaaacttcgtacagatacgaactctaaaacgcagccaggatgtgagg
aagcagctgctgggaatcatggacaggcacaaattggatgtcgtatccgctggaaaaaac
tctgtgcgcattcagaaggcaatctgctccggattcttccgcaatgcagcaaaaaaggat
ccgcaggagggatatcgtaccctggtcgactcccaggtcgtttacattcatccgtcgagt
gctctcttcaatcgccagccagagtgggtcatctatcacgagctggtgcagaccaccaag
gagtatatgcgtgaagtaacaacgatcgatcccaaatggttggtggaatttgctccgtcc
ttcttccgcttctcggaccccacgaagctaagcaaattcaagaagaatcagcgcctggag
ccactgtacaataagtacgaggagcccaatgcctggcgtatctcacgcgttcgtcgacgt
cgcaattaa

DBGET integrated database retrieval system