KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8314
Entry
Dmel_CG8314       CDS       T00030                                 

Gene name
CG8314
Definition
(RefSeq) uncharacterized protein
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG8314 (CG8314)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Dmel_CG8314 (CG8314)
Membrane trafficking [BR:dme04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    Dmel_CG8314 (CG8314)
SSDB
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 36757
NCBI-ProteinID: NP_611070
FlyBase: FBgn0034057
UniProt: Q7K3T4
Position
2R
AA seq 293 aa
MNYSYSALSPGGSGGFGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRLI
LLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVPRGNATKEMIEQMGYREGQMF
YKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHT
LFLVLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQ
TGIEQLKKEEARWAKKSRLKSIQSVFGRFSLAWFSPFTEPSCRTRFNSHFYSV
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaactactcgtactccgcgctgtcgcccggcggtagcggaggattcggtggcgttgac
cagcacaaccgatgttgcggaaacaaggcctggtgcgtcaaggacatctgcggcattgtg
tgcgtaatcatgacctggctgcttatcctgttcgccgaattcgtggtcatgcggctgatc
cttctgcccagcaactataccgtcttcagtaccatcaacatgatcatattccaggcactc
gccttcctggccttcgcctcgcacatacgcacaatgctctcggatccgggcgctgtaccg
cgcggaaatgccaccaaggagatgatcgagcagatgggctaccgcgagggtcagatgttc
tacaagtgccccaagtgctgcagtatcaagccggaacgagctcatcactgttccgtctgc
cagcgctgcatccgcaagatggatcaccactgtccgtgggtaaataattgcgtgggcgag
aacaatcaaaagtactttgtgctcttcaccttctatatcgcttcgatctccgtgcacacg
ctcttcctggtgctcacccagttcgcggagtgcgtgaaaaacgactggcgcacctgctcg
ccgtactctccgccggccactatattcctgctgctttttctcacctttgagggccttatg
ttcggcatattcaccatcatcatgctggccactcagctgacggctatcctaaacgatcag
acgggcatcgaacagctgaagaaggaggaggcccgctgggcgaagaaatcgcgcctcaag
agcatccagtcggtgttcggacgcttctcgttggcctggttttcaccattcacggagccc
tcgtgccgcacaagattcaactcgcacttctattcagtctga

DBGET integrated database retrieval system