KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8319
Entry
Dmel_CG8319       CDS       T00030                                 

Gene name
CG8319
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 zf-AD zf-C2H2_jaz zf-Di19 zf-C2H2_6 zf-met zf-C2H2_8 zf-C2HE OrfB_Zn_ribbon zf-RING_11
Other DBs
NCBI-GeneID: 41165
NCBI-ProteinID: NP_649920
FlyBase: FBgn0037722
UniProt: Q9VHA4
Position
3R
AA seq 383 aa
MEDLCRICGGASENMLGIFDDQVEEYVDGAKLAEMVKTCADVQLDPDDAMPQKMCISCVH
DARTAYGFKRRCEENYKKFYLAILNGQVIKDEPNEEDFLFIENPDKGNLEAKKKLNKEIK
KTHQTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQINLLDHMKVHSNSHVCQ
NCEERFLFKADLDNHQCYRNSNSTVECPECLKVFSSTQSLDSHKCKDMQERSPFQCPHCQ
QAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFCV
SNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFR
EKHHLKRHFLGKHRDGDQKLKLK
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggaggacctgtgtcgaatttgtggcggggcctcggaaaacatgctgggcattttcgac
gatcaggtggaagaatatgttgatggagccaagctcgctgagatggtgaagacatgtgcc
gacgtgcagttggatcccgacgacgctatgccccaaaaaatgtgcatttcctgtgtccac
gatgcacgaactgcttacggattcaagcgaagatgcgaagagaactacaagaagttctat
ttggcgatattaaatgggcaggtcatcaaggacgagcccaacgaggaggatttcctattc
attgagaacccagacaaaggcaatctggaagcaaagaagaaactcaacaaggaaattaaa
aagacacatcaaacagcttccagaacaaccaagtcttccataacaaccagtagagctggc
agacagctaaggagtataaagaatcagactttcaaatgcgaactatgcatcaaacagttc
aagcgccaaataaacctcctggaccacatgaaggttcacagcaattcacacgtatgccaa
aactgcgaagagcgttttctgttcaaggccgatctggataaccaccaatgttatcgcaat
agcaattccaccgtcgagtgcccggaatgcttaaaggtcttttcaagcacccagagcctg
gacagccacaaatgcaaggatatgcaggagcgttcgccctttcagtgcccccactgtcag
caggcctttactcgcgaacaaaacctcaaggcgcacctgttgatccacgcggaatcgaaa
cagggaaacggaccccacaaatgttcatactgccaaacgggattcttcaacaagtcggcc
ctcaaggtgcacatccatgcgcacatgggcgaacggccgcatgcctgtcccttctgcgtg
tccaacttccgttccaagcaggcccttaaggtccacatccgcatacacacgggcgagaag
ccctaccaatgcccccactgccccaagactttttcggacaacaataacctggcgaagcac
cgacgacgccactcggatgaacggccctacaagtgttccatctgcctgcaggacttccgg
gagaaacatcatctgaagcggcactttctgggcaagcatcgggatggagatcaaaagcta
aagctaaagtga

DBGET integrated database retrieval system