KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9739
Entry
Dmel_CG9739       CDS       T00030                                 

Symbol
fz2
Name
(RefSeq) frizzled 2, isoform C
  KO
K02375  frizzled 5/8
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG9739 (fz2)
   04150 mTOR signaling pathway
    Dmel_CG9739 (fz2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dme04030]
    Dmel_CG9739 (fz2)
G protein-coupled receptors [BR:dme04030]
 Frizzled / Smoothened family
  Dmel_CG9739 (fz2)
SSDB
Motif
Pfam: Frizzled Fz Dsh_C
Other DBs
NCBI-GeneID: 40090
NCBI-ProteinID: NP_001097643
FlyBase: FBgn0016797
UniProt: Q9VVX3 B7Z072
Position
3L
AA seq 694 aa
MRHNRLKVLILGLVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAPGYGVPVIPKDP
NLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSM
YTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQ
PSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNC
QNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNC
GIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACY
FMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTW
FLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHL
KTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSV
LYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITS
GVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRPPIPHPYAGSGMGMPVGSAAGSL
LATPYTQAGGASVASTSHHHLHHHVLKQPAASHV
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgagacacaatcgactgaaggtcctgatcctgggactcgtcctcctgctgacatcttgt
cgagcggatggaccgctgcacagtgcggatcacggcatgggcggaatgggcatgggtggt
cacggcctggacgcgagtcccgcacccggttacggagtgccagtcatacccaaggatccc
aatctgcgatgcgaggagatcaccataccaatgtgtcggggcattggctacaacatgaca
tccttccccaacgaaatgaaccatgagacccaggacgaagcgggcctggaggtgcaccag
ttctggcccctggtggagatcaaatgctcgccggacctcaagttcttcctgtgcagcatg
tacacgcccatctgcctggaggattaccacaagccgctgcccgtttgccggagtgtctgc
gagagagcccgctcgggatgcgcacccatcatgcagcagtacagcttcgaatggccggag
agaatggcgtgcgagcacttgcctcttcatggtgaccccgacaatctgtgcatggaacag
ccctcgtacacggaggctggcagcggtggcagctcgggcggatcgggtggctctggcagc
ggttccggctccggcggcaaacggaagcaaggaggcagtggctcgggcggcagtggggcc
ggcggcagcagcggttccacctcaacgaagccgtgccgcggacgcaattcaaaaaactgc
caaaatccccaaggagaaaaggcaagcggaaaagagtgcagctgctcgtgccgctcccca
ctcatcttcctggggaaggagcagctgctgcagcagcagtcgcagatgcccatgatgcac
catccacaccactggtacatgaacctcactgtccaaaggatcgccggcgttccaaactgc
ggcataccgtgcaaggggcccttcttcagcaacgacgaaaaggatttcgccggcctctgg
atcgccctgtggtcgggactgtgcttctgcagcacgctcatgaccctaaccacattcatc
atcgacaccgaaaggtttaagtacccggagcggcccattgtcttcctctccgcctgctac
ttcatggtggcagtgggctacctgtcgcgcaacttcctgcagaacgaggagatcgcctgc
gacggcctgctgctccgggaaagctccacgggtccgcactcgtgcaccctggtcttcctg
cttacctacttctttggcatggcctcgtccatctggtgggtgatcctcagtttcacctgg
ttcctggccgctggtctgaagtggggcaatgaggccatcaccaagcactcgcagtacttc
cacctggccgcctggttgattcccactgtccagtccgtggccgtactcctgctctcggcg
gtggatggcgatcccattctgggcatctgctatgtgggcaacctcaatccggatcaccta
aagacctttgtgctggccccgctcttcgtttacctcgtaatcggcaccaccttcctgatg
gccggctttgtgtccctcttccgcatccgctcggttatcaagcaacagggcggtgtagga
gctggtgtcaaggcggacaagctggagaaactgatgatcaggattggcatcttctcggtg
ctctacacggtgccggccaccatagttatcggatgttacctgtacgaagcagcctacttt
gaggactggatcaaggccctggcctgtccatgcgcccaggtgaagggtcccggcaagaag
cctctctactcggtcctgatgctcaagtacttcatggccctggccgtgggcatcacctcg
ggcgtgtggatctggtctggcaagacgctggagagctggcgacgcttctggcggagactc
ctaggagcgccggaccgcacgggcgccaaccaggcgctgatcaagcagcggcctccgatc
ccgcatccctatgccggatctggaatgggaatgcccgtgggctcggcggcgggctccctg
ctggccacgccctacacccaggcgggcggagcctcggtggcctccaccagccaccaccac
ctgcaccaccacgttctcaagcagccggcggccagccacgtatga

DBGET integrated database retrieval system