KEGG   Drosophila mojavensis: Dmoj_GI19320Help
Entry
Dmoj_GI19320      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00340  Histidine metabolism
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Dmoj_GI19320
Enzymes [BR:dmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     Dmoj_GI19320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 6579063
NCBI-ProteinID: XP_002004960
FlyBase: FBgn0142058
UniProt: B4KN68
Position
Unknown
AA seq 817 aa AA seqDB search
MDFKEYRQRGKEMVDYIADYLENIRERRVFPDVSPGYMRQLLPESAPVDGEPWPKIFGDV
ERIVMSGVTHWQSPHMHGYFPALNSMPSLLGDMLADAINCLGFTWASSPACTELEIVVMN
WLGKMIGLPDEFLHLTNNCKGGGVLQTTSSEATLVCLLAGRTRAIQRFHERNPGYQDAEI
NARLVAYCSDQAHSSVEKAALIGLVRMRYIEADEQLAMRGKLLREAIEDDIKQGLVPFWV
CATLGTTGSCSFDNLDEVGIVCREYNLWLHVDAAYAGSAFICPEFRTWLRGIERVDSIAF
NPSKWLMVHFDATAMWVRDSTAVHRTFNVEPLYLQHENSGVAVDFMHWQIPLSRRFRALK
VWFVLRSFGIKGLQRHIREGVRLAQKFEALVLADHRFELPAKRYLGLVVFRIRGENEITE
RLLKRLNYRGNQHCVPSSLKGQYVIRFTITSTHTTLDDIVKDWMEIKQVASLVLDEMNIT
ISNRVYLKDTKEKSEAFGSSLLLSNSPLSPKVVNGSFAAIFDADEFLAKTYAGIRIAHQE
SPSTRRRVRGILMSGKQFSLDSHMDVAVVRTTLDPNNCDDDGAGHSAGQAGQVAGQASIR
EDVDNEESAAEETELLELCKRSGSNPTSNNPMQSSSYSYNSNSNSNSNHNHNATPANHFR
PIALYTPQCGQPLSLIMDSAGHMYHGKRFLEPVSSLIDNSSFTSSINHQPTPITTPITTP
TEDNDWPAKTFSQLLLERYASSSSRSPDASSTDSSSLSLAAAVTPTLSRLSSLNDLASPL
LGSFASQSQPLQSALGASRFSDSDATICSAASSLESL
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggactttaaggagtatcggcaaaggggcaaggagatggtagactatatagcagactat
ttggagaacatacgggagcgtcgcgtctttccggatgtgagtccgggctatatgcgccag
ctgctgccggagtcagcgcccgtggatggggagccgtggccgaagatctttggggatgtg
gagcgcattgtgatgtcaggtgtgacccattggcagtcgccgcatatgcacggctacttt
ccggctctcaactcgatgccctcgctgctgggcgacatgctggccgatgccatcaactgt
ctgggcttcacctgggccagttcgccggcctgcacggagctggagatcgttgtgatgaac
tggctgggcaagatgattgggctgccggatgagtttctccacctgaccaacaactgcaag
ggcggcggagtgctgcagacgacgtccagtgaggcgacgctggtctgcctgctcgccggc
cgcactcgcgccatacagcgcttccatgagcgcaatcctggctaccaggatgcggagata
aacgcccgtctggtggcctactgctcggatcaggcgcactcgagcgtggagaaggccgcc
ctgattggactcgtgcgtatgcgctacatcgaggctgacgagcagctggccatgcggggc
aaactgttgcgcgaggccatcgaggacgacattaagcagggcctggtcccattctgggtg
tgtgctacgcttggcaccactggcagctgcagctttgacaatctggatgaggttggcatt
gtctgccgtgaatataatttgtggctgcacgtggatgcggcgtacgcgggcagcgccttc
atctgtccggagtttcgcacctggctgcgcggcatcgagcgcgtcgattcgatcgccttc
aatccctccaagtggctgatggtgcacttcgatgcgacggcgatgtgggtgcgcgacagc
accgcagtgcatcgcaccttcaatgtggagccgttgtatctgcagcacgagaactccggc
gtggccgtcgactttatgcactggcaaatcccgctgagtcgacgctttcgcgcgctcaag
gtgtggtttgtgctgcgctcgtttggcatcaagggtctgcagcgtcacatacgcgagggc
gtgcgtctggcccagaagttcgaggcgctggtgctggccgatcatcggttcgagctgccg
gccaagcggtatctgggcctcgttgtgttccggatacgcggcgagaacgagatcaccgaa
cggctgctgaagcgcctcaactatcgcggcaatcagcactgtgtgccgtcctcgctgaag
ggccaatatgtcatccggttcaccatcacctcgacacacactacgctggatgacatcgtc
aaggattggatggagatcaagcaggtggcctccctggtgctcgacgagatgaacatcacc
atttcgaatcgcgtctatctcaaggataccaaagagaagagcgaagcctttggctccagc
ctgttgctatcgaattcgccgctgtcgccgaaggtcgtaaatggctcctttgcggccatc
ttcgatgcggacgagtttctggccaagacctacgcgggcatacgcatagcgcatcaggag
tcgccgtcgacgcgccgtcgagtgcgcggcattctcatgtcgggcaaacagttctcgctg
gactcccacatggatgtggctgtggtgcgcaccacactggacccgaacaattgcgacgat
gacggagccgggcacagtgccggccaggctggacaggtggccgggcaggcgagcatacgc
gaggatgtggacaatgaggagtccgccgcggaagaaactgagctgctggagctgtgcaag
cgcagcgggagcaacccgacaagcaataatccaatgcagtcaagcagctatagctacaat
tccaattccaattccaattccaatcacaatcacaatgccacgcccgccaatcactttcgt
ccgattgccctgtatacgccgcagtgcggccagcccctgagcttgatcatggacagcgcc
ggtcatatgtaccatggcaagcggtttctggagcccgtcagcagcctgatcgacaacagt
tcctttaccagcagcatcaatcaccagcccacgcccattacgacgcccatcacgacgccc
acggaggataacgactggccggcgaagacgttcagccagctgctgctggaacgctatgcc
agctcatcgtcgcgctctccggacgcctcatccacggacagcagcagcctcagcctggct
gccgccgtcacgcccacactcagccgcctcagcagcctcaacgatctggcctccccgctg
ctcggctcatttgcatcacaatcgcagccactgcagtctgctttgggcgcatcgcgattc
agtgactcggatgcgaccatttgctcagctgcctcatcgctggaatccttataa

DBGET integrated database retrieval system