KEGG   Drosophila mojavensis: Dmoj_GI23478
Entry
Dmoj_GI23478      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
Organism
dmo  Drosophila mojavensis
SSDB
Motif
Pfam: COesterase Abhydrolase_3
Other DBs
NCBI-GeneID: 6572612
NCBI-ProteinID: XP_001998718
FlyBase: FBgn0146204
UniProt: B4K6R3
Position
Unknown
AA seq 570 aa
MNKNIGFVERLRWRLKTIEHKLQQYRLTTNESVVTDTEYGKVRGVKRLTIYDLPYFSFEG
IPYAQPPVGELRFRAPQRPTPWEGVRDCTQPKDIAVQVNFVFDKVEGSEDCLYLNVYTNN
LSPAKPRPVLVWIHGGGFIIGEANRDWYGPDYFMKEDVVLVTIQYRLGALGFLSLKTPGL
NVPGNAGLKDQVMALKWIKNNCASFGGDPDCITVFGESAGAASTHYMMLTDQTQGLFHRG
ILQSGSAIAPWAFNGDITSRAFRIAKLAGYKGEDNEKDVLQFLQTVRARDLIRVEEQVLT
PEEHANKVMFAFGPALEPYTTPECVLPKHPLEMMKTAWSNSIPMMIGNTSYEGLLWVPEI
KLMPQVVQQVDSGTPFVPRELAAINSEKVSSWGQKIRSAHLTGEKATPDNYMDLCSIYYF
VFPALRVVRSRHAHAAGSPVYFYRYDFDSEELIFPYRIMRYGRGVKGVSHADDLTYQFAT
LLAHRMPKESREYRNIERTVGIWTQFARTGNPYSSEINGLDMITWDPVRKSDESIKCLNI
SDELKFIELPEWPKLKIWESLYDDNRALLF
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgaacaaaaacatcggctttgttgagcggctgcgctggcgtttgaaaacaatcgagcat
aaactccaacaatatcgtctgaccacaaatgagtcggtcgtcaccgacacggaatatggc
aaagtgcggggcgttaagcgcttgaccatctacgatctgccctactttagttttgagggc
ataccctatgcacagccgcccgttggggagctgcgtttccgtgccccgcagcgacccacg
ccctgggagggcgtacgggactgcacccagcccaaggacatagcagtgcaggtgaatttc
gtcttcgacaaggtcgagggctccgaggattgcctctatctgaatgtctacacgaataat
ctcagtccagccaagccacgcccagttctggtctggatacatggcggcggcttcatcatt
ggcgaggccaatcgcgactggtacggcccggactacttcatgaaggaggatgttgtgctg
gtcaccattcagtatcgtttgggtgctctgggcttcctcagcttgaaaactcctggcttg
aatgtgccgggcaatgcaggtctcaaggatcaggtgatggctctgaagtggattaagaac
aattgcgccagctttggcggcgatcccgattgcataacggtgtttggcgagagtgctgga
gctgcctccacccactacatgatgctgacggaccaaacgcagggactcttccatcgtggc
atcctgcagtcgggcagcgccattgcgccttgggccttcaatggcgacattacgtcgcgc
gccttccggattgccaagctggcgggctacaagggcgaggacaacgagaaggatgtgcta
cagtttctgcagacagtgcgtgccagggacctgatacgcgtggaggagcaggtgctgacg
cccgaggagcatgcgaacaaggtgatgtttgcctttggccccgcgctggagccatatacc
acgcccgagtgcgtcctgccgaagcatccgctcgagatgatgaagaccgcgtggagcaac
tcgatacccatgatgataggcaacacctcgtacgagggtttgctctgggtgccagagatc
aaactgatgccccaggtggtgcagcaggtggactcaggcacgcccttcgttccccgcgag
ctggcagcgatcaacagcgaaaaggtcagcagctggggtcagaagatacgcagcgctcat
ttgacaggcgagaaggctacacctgataattatatggatctctgttccatttattatttt
gtctttcctgctctgcgcgtggtccgctcgagacacgcccatgctgctggctcgcccgta
tacttctatcgctacgacttcgattcggaggagttgatattcccctaccgtatcatgcgt
tacggccgtggtgtcaagggcgtcagtcatgcggacgatttgacgtatcagttcgccact
ctcctggcacaccgcatgccgaaggagagtcgggagtaccgcaacattgagcgcacggtg
ggcatctggacacagtttgcgaggaccggcaacccgtacagctcggagatcaatggcctg
gacatgattacctgggatccggtgcggaagagcgatgagagcatcaaatgcctaaacatt
agcgatgaattgaagtttattgagctgcccgaatggccgaagctgaagatctgggagagt
ctctacgatgataacagggcgctgctgttctaa

DBGET integrated database retrieval system