KEGG   Dendroctonus ponderosae (mountain pine beetle): 109536992Help
Entry
109536992         CDS       T04899                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpa01001]
    109536992
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpa04131]
    109536992
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dpa04812]
    109536992
   04147 Exosome [BR:dpa04147]
    109536992
Enzymes [BR:dpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109536992
Protein kinases [BR:dpa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   109536992
Membrane trafficking [BR:dpa04131]
 Others
  Actin-binding proteins
   Others
    109536992
Cytoskeleton proteins [BR:dpa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     109536992
Exosome [BR:dpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109536992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig Titin_Ig-rpts V-set C2-set_2 C1-set Spectrin Adeno_E3_CR1
Motif
Other DBs
NCBI-GeneID: 109536992
NCBI-ProteinID: XP_019759052
Position
Unknown
AA seq 20892 aa AA seqDB search
MEEKPSLSCLEATTSVILPGGIDKEGRPIFLVTVPTDTTSLEITTPLKYLLSIFSKSSKR
AGFTVLLDARKGSWRLSRSCIRQTIDTFPEGELRKLVVLKPDGFWDKQRVENCTVPQKDQ
EVIFIPRSRLNKFVDQSQLPVELDGGLIYSHEKWIENRQKVEEFYKDAEVTIKELEELRQ
HVIRSKALRASQVEEAINTSYDMEEATKMLVHNATETGKELVQNIEYENRTRKLSVDHID
QTFTPQDTLDTIERIHSIVNEIREKQQEIETNWNEMEKSLVDTKDLNELKKKVVKVTNWI
LGPAEQLMSFNQKVGYDVASAEELRRDHETIELQCWETYGAYAELLHRINSMSESADENL
VAQHKDLISQKEFMDFVCKSFAMRVEKRRNILITSLRFFRLVSEYFDKTGEVFDSLVMGT
DINDFDAAAFKLDELQESQSYLESVEQEILREGEKLSDMLSMPVKDALGQEIEADYSEDI
VNIHDVLDATVARKNIFSDSVELQKLTLQQITFIDRYEKDAEQAINWLGDILRVMLRDYG
HVGCTVYEIQLQKDEHQAFQETAKCTYNYGCQLLNASLQLRQSCKLPIEPHSNMFHILRN
NWDRTQSISQEQMTRLRVSAVFHRSIEEHCNQLRDLREAVATIPILSLAKRRLKVHQYFD
DREKLMVEVGRMVRLGRLLRSRLKEPLYEEESFFTPASVANHIEDEFQKLCNNSIKNNEI
AIEAISERLSEVTQLSEELDQALKSAQQDCIVFSTTSTSTSTVGEVNNNYIDLPKIDISS
MDNENKPFEKVNKTDDQLRSDEEFLTASDTTLQHSRSSSYNTASECEQHFSSWWQHGKDD
MRENVSKEKMVLAVGCPPEGELPPSKEVLKPSPEVPPGKIVREVTETTHIKVQQRHNLGV
KSFVLTSEIVREKDSEGPITTREETVKYQTEDGKEVTHKVDKPGANFHPDDLLARINECG
DWIQLKILEITPELTTLGNTLAEALELQKAHNEVLRQLQNKQSPVEELLRQADQLIATQR
PRAEVYAAMAESLGRAWRDINATLELRKLILDLNVQYHTKAEEFFGKNDALESACSDSNL
PTDIDAVKALLTTIHDLRRSLLETLMGALQAGNTLLSKLKELGAEGTLDSRPERIRSSVS
KAISQVQGWLDELHIKRQILEVTFNRRKVQLEQCLALALLASDLKELEEVLNDRRNLLAN
STQLGDSSSSAELLLHEHKKLLPEARQLQERALKITKATEQLGASGYFAGDQATQKSYVI
LSSTSDYLADLQQREMLLERVINFFRASHTVLTKLDQLEIQLKTTELSRSSPKLAELHAQ
CARTIEDSTAAPIAEGYGILELAAHGGGTEGVKKMVQELENMKIVLNSLCTAHREENKRI
TAALNNFIERHDEIYNWLVTIAEAFLQGHQDMGGDLRLAEDFLQLHNRLQVDLQTKGNEI
NQLLLTLPPILEYLEDNQRIDVDSKVEGLHNRWMKLKNLLENRLDLARIYVKFFMEVDIV
NREMDALEDSTRGRESVDESTMRTIEEKFELLVPYFQSAKNTGLTFISESHRISEPHLDT
QRARKYVESVLERLSGRQLNVTKSWQTFRDEVVEKREILVRLERIMAESTKTISWVTKLD
SQLYPIITTSSTNPTEIVALLEHKLENVLPDIKKAQQEVGQKIKSAEELVAKAGAADEKT
LGIKNKLSELSQKLVEISSEYQILLQVLIGYFKNLEEIDKKAENYNAQLEHIRLPDDLQG
IESVLRESEVTRETILERFRFAQTECEQIEQRIKNQEPTEAAQHDIEKLQHVLELRTSEF
ECQWRETNEILRTCRKVSELTKETKEVRNNINEVRSQVTELRTQGGDSLSASKAACDNFK
QFTRVIETLDLRIIKLKDESKKLEEELPAEAPRIQSEVRELESQWSDVKVQVEDTKVVLD
KNVKYFELINEANDWYREGSKLLVGIARKSTAVKQPEEAERLLEEISSFRQPGEERQSER
IQEISTLAHQIYGPDESKHAPLINANREMLESFSSISNELAQLSSNLISAEQEKQRILKE
QEEARRAEEARRLEEERLAHERRLAEERRLAEEARLAQELRKAEEARLVEAKRLAEEKLR
EEKAKLAEEARLAEEKRAAEERRLAEEAKLAEERRREQEAILAEEAKKVEAAKREVEKLK
IQQIQFLEEAKRAEEERRRMEEEERQQLQKARMEDDARRLEEARILEEQNRLAQEARLLE
EERLREKHNELEAERQRLEEEKLRAEKARMEEERRLAEQRQAEEEQLRSQKAQMETERLR
AEQARLEDEERRVRQAQLDEERRKAEELRLDQMRKAEEIRLQEMRQAEQTRLEEARKQED
ADRQKRLEEEMIRIEQTRIEEQKRIEEEIRKQHSVQITEIKEVHKVESFQKEKSPMVQEP
QESPVFITPLSDIVIQEGSKLTFICQVTGHPNPTVTWFKAGVPIQHNPDYHTSFDNGICS
LTIEETFAEDSAKYTCKASNSAGIAETSASLIVKETEPDDQLMAPTFVKMLQPGVAKEGA
EFQFECRVEGNPLPTVQWFRNNQCIDSSPDYSITYNNGEAILSIDKVSSDYKADYTCKAT
NDLGTAQSTANLVVTALEPAEAPVFVTPLSNVMARAGQKIKLECEVVGLPPPILTWSHNG
KAVKETRETKLQFEGNKATLVVLEAFPKDAGTYTVNAKNIAGEASSTSTVSVKGRLPNET
SDSELASDMEPVKPSIQLPLANTTVKEGNQIRLDCVIVGQPEPEVIWYHDGRPVKESPDF
QLLFQGDRCSLVIQDALPEDAGEYKVVALNSAGEASSQCVLAVEPKQAEEPVEKPSGTPP
KFTKLLTDILVSEEDKVVFEGNVIGEPKPELKWLLNNIAITDTEHFKTQIDDSGNFKLEI
ENVKPEDKGVYTVKASNDAGEAKCFAQLIVKSSKLAEAAKPYEEVKSAPVFKEMFNDRIA
FADTPTKFECIVVGKPKPKVKWLFNGNPISGEGVLISTSGDRQVLSIPSLKPENQGTITC
VAENESGKASCAASLTVQSTSEIALPEQVLPTTSSLIPTDIKQHVETSYSVNREVVTQSS
TSSSSKLISSSISSSEPHVEEHKTVSQESQSFKQVNQGAPQTQKTTRIEEYHKVGNEPPV
ITEKTYIYGDQSDSSNIKEMKSVDQRQIITKPSRIVRAPKWVTPVIGKIVDQNVDVLLEG
ILDGQPIPKVVWTKDGKELVEDERTKIKFALNKATVEIKDTNVNDAGRYSCTATNDGGTA
ISTADLVIRKTIFPPVFGRRLQAQVIKKNDRIIMEVEVTGTPEPTITWLKDGIPIKDALS
DAKIKSMGHSHTLTIDKADLKHNGRYMIRAVNTGGEAQSIADMAVYEPTPDTMVEVVKTV
VFEDVKKHETLASTADRTSSTISTKAPLVPTKIEVAPLSSEISQSFSKKSESTSTVEQKS
SQQSHTYKLEHKTPEIPLPKPIERKTPTFEKRTDYEISHEFVPGENKEVIEEKKTVIEEG
GIETSSISKQSSLQYFVKKIKEGDAAPTPKEVPVEPIQPLKPEIFQKFTTVDSEVKKETA
APTKAPPVSTFTEIRTIDNKSTAPITQEFRSVSSTKEVTREVKTLPFAQEYKSSSSTTEK
TSHPFREEFQRETTKTQPTSKPFTQEYSSFSSRQQISAPQEYKTYSSEVIREFDLKPEPP
AEICFPPTKEPTFKQDSVQERVHKLSTSSKELPAHEVPQGGVKIFPTPQPAKTAESFSER
KEFSEKVEKSYQSSSYQTSSSSFSKSYESSSSPAFTGRKTPEVPSVQKIWSTKQELFDRP
ASVASSSYSTERHSYSRPLSALSGEPSTEALQMEKQWAHKFMEPQTDKPWTRPQSAGPKP
TSSWSTQSTLEKRWAPVEMKSEKIVQESRTFLGKTPVLVPHYIGEVTRLETTVKDQTSDS
YSSSKSEHIVEESNLKPSLKSWPPGPPVQEYVPPPPRPYPTIESIRVRPVSVQDITDEVY
LEPGPPPEIGYAEPPTGRRRSYVETIEHDLKQELQREPSKVPPCAVRTIPPPPLPPKKEI
PQAPPVPARPIKQVETKPKKPLKELPYVPFEKFPDLEPFPFKPDPDRPRPPRTGPPPTPS
RFVKGRFTDSDYESDFENVRIPPKWKPSMSDTEEPRYRRVRAPLLVATGRSRSQEPEPLP
PSKFDRPPQFHGPPRPEVDFEEFRRKKDASQIKKMTKHFEQVRREVSPPKIKPASPPTYV
YPEKRPESPKVKKKVVIDGYMADTDEPFQQRVIKTEHFREEKTESRHISQSSQKIYESSS
STQKTFVPKTRVCKYPAKKHQSSVSSVKKEFVATPIITSQSTQEYTEEHQKQTHLESFPY
QPEPPKVKSTKAPPPPSPSKFIKGEFRESDYESDYEGRVPPIWGQHVDKQYKPVRPVLTP
THPNYQPPARTPTPPTEFERPPAVEGQPRPKFEPIEKITPVPKSIVRKPKALAAAPITDL
VVATPAVPMKNVYIQPGSPPEIGYAPGPRKSQFYSSTTSAPYKNAVQTETSNIVHFDEST
DTCKRTMSVQQTHKVIKFGDQYRKQEKTTQRESYPFSPEPDRSRRSTSVPPPPTPSKFIR
GEFRESDYESEVESAKIKPKWTPGGSDADALHYRRVKAPTPTSDYSAYSSQQQRARAPME
FDSGPIQSTTTTITDITDEEISRQQLKTSSESSTKQILRRTNSYEPPSALKPGTPPEYGY
VSDQRLTKTSATKLASQHMNSMTKDFKSKTQQFVQDIMSDVSKKQQQTSNAKTETDGDAQ
VYREESRAMSHGTKHVDPDTGLIYFKYDFGYEFGIVLPGESKSGGIPVPKKTVIEPPKRT
VDIDMPVYHETSNLNNVNSSNSAPTPQFKPKKFTNKWDPTSESEMSEYEGDSKRKSGLSQ
GSRWEPSSCSPYSLSPSLPSTSPAFNHTYADRVGAQTPPSRPNTPGANKFIIQPGQPRPP
LFITPLRDIAVVSGQTAKFECIVQSEPPPNILWSQNGRILENSNDHQIHFRNGVCRLIIK
QAYPEDAGTYTVVARNALGEAQVSASMVVETRASIDTRSMHKGAYDKTQHLEQSKFVEPQ
YQIEEISKSKPIFVVPLSDPQPCQEGRNIHLECRLEPMGDPTMRVEWFCNGRPVIVGSRL
RTYNDFGFVALDILQTTAQDSGEYTVRAVNHLGSAHTSACVRVIASSDIITDTQHEQSLE
QIQMLEDASRYRKHVQEDVTVLQAPQFTRPLHNIETVEGTNIHMECRLQPVGDSSMRVEW
FCNGFPVKTGHRFRPAYDFDYVALDLLSVYPVDSGIYTCQARNQLGEAVTSCSVKVIAKK
DLLFDSQHPAGLEKIQHLEDSSRYKRTEFVDEQVTVKPRFVTKPKSLENMNEGQHAHFEC
KIEPVTDTNLKVEWFKNGRPVTVGHRFRPIHDFGYVALDIIDLIAEDSGTYTCRATNLIG
SDETNCSLRCRQSGQIITSTVNETGLQQIQHLEDRSRYQRREDVEEITTQAPMFTTSLKN
IDIKEGQRAHFECRLIPVSDATMKVEWFHNGQPLKSGSRFTETNSFGFVALDILYTYPED
AGTYTCRATNALGEAVTSAICNVQSKKSLYLESVHEGALQRLTELEDSSRYQRKEVHEET
ISQAPVFTVPLKDLRTAENQAAHFEARLIPVGDSRLKVEWLRNGVAIQASNRITTMHDFG
YVALNMKYVNPEDSGTYTCRAVNDLGEAITSAVLDVKSKASLQLESQHEGALQKLRQLED
SSRYQRREEQEVQVTQAPFFSTQLNGPTEIIEGQSAHYECRIEPYPDSNLKVEWFHNGKP
LATGHRFRNAYDFGFASLDILTAYAEDSGTYTCKATNLIGQAQSSVQTSVRSKASIIRDT
QHEGALEKIHYLEDESKYRKVTRDEAVILEKPQFGRGLKTIENLPEGQSAHLEATLTPVN
DPTMRVEWFCNGRPIQTGHRFKTTYDFGFVALDILYAYAEDSGTYMCRARNAVGEAVTTA
AVSVVKSKNLYLETMDEQRLKKLKELETYERPKREEVEPLPQKPVFLTPLISLDNLQEGQ
HAHLETRVEPINDANLKIEWFVNGVKLKTGHRFRTTHDFGYVALDILYAYAEDSGTYMCK
ATNLVGEAVNTCTIKVGGGRGILLDTQHPEGLQKIRELEAQGHPTRLEVEEPVPTAPRFI
TELRGTTEIYEGQTAHFEAQVEPIHDSSLRIEFYHNGKPLPHGNRFHITFDFGYIALDIT
HAVPEDAGEYSVKAINNLGQCVSSINLRVISRDNIITESQRPEGLDKIRQLEAHEPYRRP
EVEDQVTRQRPVFTQPLQNIDFIREGQKAHFEGRLIPVGDPTLKVEWFRNEKPLEDSSRI
SKLHDFGYVSLDIQHVRAEDEGIYLCRASNPLGEAVTTASMKIRTEANIQLDTQHPEAQR
KIAQLEQPLAPRPEAPERIFEKPIFTQLLTGPTELWEGQHAHFEARVVPVGDASLRFEWY
VNGVELKLGSRFKVTHDFGFVTLDILSTVPNDSGVYTCKAINKSGEAVSSISMKVKSRSN
IIGEPLHPEAWEQIRLKEAEMNKVPEMFVDTTPQQPPVFTTHLKSYDKLVEGQHVYLEAQ
VEPRTDPNLRIEWFKNGVSLSTGTRLRSTFDFGLVTLSINGLRGDDSAIYTCKATNKLGE
AISTCSLKIEDKDWLLGHSLHPDAIPKIEELERPQAPRPGLPEPTYELPMFISHLNNVEC
FEGDSVHFECNVEPSKDPTMKIEWFVNNKPLPTGAKYKSTYDFGFIALDITHSYEEDSGV
YTCKASNSKGSATTSGTLRCTGKKSIYYDTQHPQGQAGLEAIDEVDQAFAAKAKHPGFAA
DKEFPKPVWTVPLNPEFTVLEGKPLHLEGSVEPKEDPNLKIEWFFNGKSLDHASRFKLTS
DFGFVTLDLTDVYERDQGVYTAKASNKAGEAFTSTTIYCTTKANLIERTQHPKGQEGLEK
IQNLEDSLNRPEMPFLEGEEGHAPVFTSEFTNLTNLGEGEIAHFEAGLTPIGDQTMVVEW
FYNEKTIEASHRFRTVHAFGMVVLEVLGVKTEDSGTFTCRATNKWGMAEQSVTLECVERE
AGQKPKFTTHIQDIVGLKDGQSAHFECTLIPINDPQLKVEWYHNGQPILHSSRIKTVSDF
GFVVMDISYIQDQDSGEYVCRAYNKYGEDFTRATISAHGKGGVFSDSLQPDSLAKIRELE
SFQGQQAQAPTSPVTEPPKFITQIQDITKLAEGQSAHFEARLTPVTDPDLVVEWYYNGKK
LPHGHRYRTFHDFGIVILDILYCYEENSGVYECRAYNKYGQDATKATLKCTSKTNLILDS
QLPRGMEGGLEKIQTLEDSLIRTRDEKEEVTKGRAPVFTVPLSNVDSLREGENVHFEARL
IPTDDPKLKVEWFWNGKPLRTGSRFRTFCDFGFVILEISPVYPEDSGEYSCRATNEYGEA
VTTASMKVSGKRSIILESQLPKGMEGTIDKIAELEGLGLAPSQATPEDDTGKPPEFITTP
SDLILGENSLAHFECRLTPINDPSMRVEWFHNGKALWAGSRIKTINDFGFVILEVAGIYQ
RDSGLYTCKATNKHGEATVSCTLQVKGRQGIILEPQLPSNFRSGTQSIQKLEEELYKKEE
ILAEEEQPNPPRFIVEIKDNIDVPEGSPVHFDCRVEPKNDSSMRIEWFFNGKPFATGSRV
HQINDFGFISLDIDYTYTRDAGEYICKATNKWGYAITKARVTSKSKRTIDFESQLPAGMT
ADKLKELEKGPVSVAPQADKVYGPPKFITHIQSVTVEESESVRFECRVEPKDDPKLRVEW
YRNGKLLPAGHRYRTVYDLGFVSLDILDVYSEDSGEYVCRAVNDHGEDFTKAHITCKKLP
NIILQNQVPKGMKKSEALMQMEAAIKKYTSEVYLTEDDLFDVEKKQPPRFVTQILEQTDL
VERQTTKFECQLAPVGDPNMKVEWFLNGKPLPHKNRFTPIYDFGYVAMNFGWVYPEDSGE
YLCRATNLYGMDETRAVIQVAGKPGIIYESQLPKGMKSIEKIREMEASWLVTPEIAEEEA
KPRSAPVFISKPEPVIVEEGEWARFCCRVTGHPKPRVMWLINGHTVVNGSRYKLTYDGMY
HMDIPKTRQYDTGKIEVIARSSVGEAIAETELKIIPRQDDYRGVLKNSPRPWYDLELSQY
QKERQETELEKVFDERNSTLRESGLNVSGVHVQSKEYSEPETEWQKHIKSKKGEEYYTKI
QQLENEQVSKEVRLREASHQITIPGEKIVSSSLARGMAQQYQDNLEQVPERPQLQSIPRL
PKAEPAKITPHKDQVSLRKTDKSKEEMQIEYEIDSKSGAYPPGPTESGVHGREVYVTKQK
QTQKERQGDLEITRNITATETTDVEHKAKTQELLVQGQVLPTNPPLFTKKIQPCRAFEND
SARFEVEFDGDPLPKVTWFREDFPITSSPDLKIYTFSTKSILVLRQVFMEDSGVFSVIAE
NRGGTAKCSANLVVQERRRQGRGGIIPPNFATTIQSTSASAGQLVRFDARINGTKPIDVY
WLKNGKKITSDIRYKTLEEDDLYTLLIIELVPEDTAKYECVAMNQSDEARCEADLAVLSP
TAPQKPSKPTTPGTEKPPTIVEPLKDQNIREGQAVAFKCKITGKPTPSAKWLKADKVIKP
SRYFQMSKEGDYCTLRISEAFPEDEGVYKCVAENPAGTVTAQAKLRVLAPETQELAPSLT
PMKDVIVPEGSPAQFKTSIAGKPKPTIQWLREGFLIPESPDFQMIQEGSNAILLISTTYE
EDSGVFACRATSSAGSVEQSAKLIVKRRPGTFRKSPSTAVSSQPGTTPIATQLNGAPTPG
GVGVSSVPFAPGSKTGQPLEPNELPVGDESLLWRRFARKQLETSEEFKDLSKPKQVQPWT
EEQIVLKKAKVEHREPVKEKLEEVHLKVSKPVQKEIPRAVLEDVELKPVSLEKHITDSFV
AQSIEQAQVAQQDWRTAPKTPSSQIRSATEDSTLLTLDQKQQEHIVKTTPEPAQKDWRTP
KPADIAAELKRQAWRQTLEKQDSVEIDIDTVLAKAQHAVRKIPTPQPQQAKIIPWTEEKI
TLKAAPKDQIAKFKEIPKEKLEDVVLKPVTLEEIQALKQAKLEKPREPGEPVPWIEEDID
LKPTPQEKKEIPKETLEEVHLKSVDLTELLDTKLTPLRLEGEGIPWTEEEISLKPTLPEK
KEIPRETLEEVALKPITKIPDIRDTELKPLITERKPGEPIPWTEEEIRLKHAVIEKKEIT
KEQLEDFSLKPLAQIPGQKPAELLPVQQEIQEETLEIQLEQQEISKQKSAAKTEIRHVED
RTLLDITKHTSELMESQPEVKTWERGSKPEAITSKQTTETTQKTIIESQQVQDTDTKAWK
RETVVQKEEHQHAPKEAPAPWNEQPITLKKTTIERKQTANETIEQVDLKPSRPIKTGDTV
VQTTEQTQIAQFDTVERTAVLSATEDTTLLQVTEHEKVSQSLTLEEKSWKRAPKTEKPTV
DATTVQHIEDASRLIFQERVEEHGETVESKTWQRGTKAVGKLEEQIAPVQHTEDTTLVSL
QEKEVVKEEIVEAKPWKRGPKTTELLPKEQQEKPLIPEEIKPKAAPKKTPLAREDEPIPW
NKQEISLKPTPKKSVEETTKIEEVSLTPIKKPVRSVDDKQIITSDVQEETTAAVQEIPSE
QNEKLSSIHHVEDKTVIEMKEQVESRKDTKLEEKTWKRGPKPEETPLEATPEEAFVAEKP
KPKQGPKSTPITQQEEPIPWNKQEISLKPTPKKKIEDAPKQEEILLTPVKKPVRSTEDKT
TTTSDVTIEERSKIELKQPDLKPGKPQEDLSSIHQVEDKMFIDMKEQVDSKTDTKLEVKS
WTRGPKPEQAPLEAKPEEALVHEEPKPTQLPQQDKILEAKPWKRGPKPTDIKPKEQQEEL
VIPEEIKPKAALDKIPLAKKEEPIPWNKQEISLKPTPKKKIEEAPKQEESSLTPVKKPVR
NIEDKTLITSDVTVEEKPDTGTQKRVTKPVHKPQEEEVSTFITPASVVEEQLEPKAWRRG
KKPVGKQPEESVEETITELPEEIRETKTVTDGLEKKTIERTRVIKKKKGNIEETTQIVTV
QEEGKTPQTTVTVVESIAPEETQPFYVVEELPTKVQETTVIEQGIPKKIIERKRVIETKK
GDRKDVTEIIVTQKPGDKPITSVTVKNVPVVKQEPIEPEYVVQELPVQILETVVTDASKT
TKKVVKTRTIQKQKDGIKETTQIVTAVEDGKKPEHVVTTEQHPAIEEESIFTVRELPLEI
LESTVIESGIPKHRTTKKRVIEKVIAGKKEITEIITSEQDDKPTETTVTVTEQDIKKRPK
KQRLEQPKEEVIPWTEQVQLKRAKAKKPQESEEEDKVQLKQIPTQPSAQAIIEELPEQIQ
VSTTVDKGKIEKTVTKTRVIKKRKGSKEETTQIVTVEKEGNIPETTIVTEKQSITEEQTT
QPIYLVKELPEEVFETTVIEEGVPKKITERKRVIKTRKDNKQEITQITTVEREDRPTETV
VTITESEATDFEEMPIEQEFAVEELPTEIYETTIIEKGKPKTVVEKKRRIKKMQDDKVQT
TEIITVEEPGKKPKTTVRTFEDTTQTIQDLEKPLIEELPEDVQEVTVIDAGVTKKKLLTK
KTLKKTKGDKEETTEIVTLEEEGQKPETVVTVTEEIIDKKKPQKIPVPQETVEIPWTKQV
ELKRTPKTNKPEEETREEIRLKPVKKSQIPQPEEAPVVQELPEEIQQTTVIDKGEAKVQV
TKTRVIKKRTGDKEETTQIVTVEEDGKEPQTTVTVEEQEVPKAVATQPIYKVEELPEKIS
ESTVVVQGIERRKVEKRRVIKTTKGKTQELTEVLTTQLEGEKPEVTITVHEIEDTLPETL
DETFETVEELPVQISETVVVDKGIRKKKVAKTRTIRKEKDGKQQITEIVTIEEEGKKPDI
QVTVHEEDKPVEKTVEKPVTDLPWTEQVKLKRTPKKQQEAPVESEIIKLKPVKPEITDTP
VTIEELPEEIHETVVTDKGKIRKQTSKKRVIKKNVTIPEKEVVQPIYKVEEEPEQILETS
VIEDGVRKKQVQKKRVIKTTKGDKQEVTEIVVLEQEGKKPEVTVRTEEIGAPKIPSEQPE
DTSIEELPIEIREEVVFDHGVSKKKVEKKRTIKKKRAGKDEITEIITVEEEGKLPETSIV
TYEQVPEEDSEKPFIEELPEETQQVVVVDEGVTKQKTIRKRIIRKSKGDKDEITEIVTLE
EEGKLAETTVSITEDDRKPDQIKPKRKPKKVEVSEILPVVEVEELPEEVQETIVIDKGVA
KKQIKKKRVIKKRRGSKEETTEIVTVEEEGKAPQIQVQVEEVQIPEEMAEQPIYTVEELP
EQVSVSTVIEGGLKKQKVQKKRIIKTRKGNKQEITELTTTEMEGKAPSTTVTITEVEAPA
DEVPVQTEYVVEELPIETQEVISVDGGVTSKTVIKKRTLKKRKDGKEQITEIVTVQEDGK
KPETTVTISEDFIHPDTIFLQPLVEELPEQISEIIVDKKGIKEKQVIKKRVIKKRKGSKD
EVTEIITLEQEGKKPERTVTVTEEETPRKPKKRVIEQKKADLPWTEQVKLKRAPKQIKPA
KEKGETVELKPVKTEEVIQELPEEIQETTVFDQGVMEKKVTKKRVIKKRKGSKDETLEIL
TVQEEGKQPETTVTIIDETPKVPDVTLKRAKKEKVKLAKGTDEKIEKLHPAKMVQPDSLL
TTMEELPTEVRETTVIEDGITRKQKTRKRVIKKRRGSKEETTEIVTVEEEGKVPQTTVTI
EEDVAPKIAEEQPLYRVEELPEEVYETTVVEQGRPQKKIVKKRVIKTKKGDKQEITEIVI
TQKGREAPVTEVIIHEESIPFEEIEQPEYAVEELPVEIQETVVVKDGISKKRVEKKRTIK
KKDKQGKDEITEIVTIHEEGKKPQTTVTVQTQDTVSDIPDRPVITELPEEISEVNVVEQG
VIKQKIKTKRTIKKRRGSKDETTEIVVIEEEGKAPLTTVLVTEEPVEDQQLIPKPKIKKT
KKQAKSESPLVTPEGYLFVPSLAHPKETQPDDVVDMLQAELIKMRLAKNLPEHVVPEDVP
KYTVTELPEEVQETTFIQDGVSKKVRSRKRVIKKRIGDKEETTEIVSVEEEGKVPQTTVT
VEEETIPEDIPEQPIYSVEELPEEISETTVLVEGRPKKRIEKKKTIKTRKGSKQEITEIT
VTEQEGKRPVTEVSIKEIDIPESEIHEGPQPEYLVEELPIEIKETVVVENGVSKKTVQKK
RTIKKRKGDKEEITEIVTSEQEDEAPRTIVSIEEKPITFQLEEVPKIVEELPTVIQEVRI
IEDGVPQKRTIKKRVIKKRRGSKEEKTEIVTVEQEGKLPKTTVTVDEITVIEEKKPKVKK
PRTEKVEEVPWTEQVQLKPSKRRPKAVEKTQLEEVDLKPFEVPEKEEEVFRVEELPVEIK
ETTVIDQKGVSKKKIVKKRVISKQKGDKHERTEIVTVEEEGKAPETTVITEEIDAPKTGG
PLYIVEELPVDVQESTFTERGVSKKKITKTRKIVKKEGDKRETTKIVTVEKEGEKPTTVV
TVEEDVAPEEASAESPSYKVVEMPVEIQETITMEGGKPRKTVVKKRKIQKQKGDKQETTE
IVTVEREGKQPETTVTVLEEIVDQLPAEVVVEEIPEEVEQTTIIEGGKSKIRTVKRRKIK
TRRGDQQEITDIVTVEEDGKKPLTTVEITEEPVPVDEKPSESKPKQTVKKTKKVTETSLL
TKDGYLVVPSLEQQEETQPEGVLDLLEMQLIKMRLQRDMPEHIAPEEVPVFEIKELPEEI
HESIELKDGIRKKVITKKRVIKKRRGDKEETTNIVSTEEEGKAPETTVTIEEQQLPEQET
VQPIYTVEELPEEVSESTVLIHGKAIKTVKKKRVIKTRKGGKQETTEIVTIEQEGQQPIT
TVEIQEIEAPEIEEVPESEYRVEELPIQIQESLVIEDGVTKKRVQKKRTIKKRKGDKDET
TEIVTIEEEGKQPETFVTIEERPTSGDVEDIPEILEELPTITEQVNVVEDGILVQRNVKR
RIIKKRRGSKEEKTEIVTVEEEGKTPETTVTIEEKPKKKTAKRVKAEKIPWNQQVQLKPT
TRKSKDIEKPEIEEVELQPFELPDKEETVFKVEELPVEIRESTVIDQKGIARKKVVKKRV
IKKQKGDKQERTEIITVEEEGKAPETSVTIEQIEAPESDSPLYVVQELPEEVQESTVVDH
GVSKKKITKTRKIVKKEGGKKEVTKIVTVEKEGEIPETVVTIEEGQTTQEAPEEQPEYIV
EELPIEIQETTVLSHGKPTKTIVKRRKIKKQIGDQQETTEIVTVERPGEKPETTVTVSKE
LVEELPEKSVTEELPEEVEQTTIIQNGKSKVKTVRRRKIQSRKGDQQETTNIITVEVEGS
QPVTTVDTTEEFIPEQHEKLKRKPKKTRTEKVTETALVSKEGYLIVPSLEEQEEVTPEEV
LDLLEMELIKMRLERDMPDHVVAEDAPKYIVKELPEEIEETTVFENGVPKKVVTKTRVIK
TRKGDKEETTHIVSVEEEGKLPQTTVTVEEETVTTKVTEQPIYTVEELPEQVSETTEIIN
GKPTKTVEKRRVIKTRKGKKQEITEIVTREQEGQQPTTTVEIEEIEAPLIKEEEPHYEVQ
ELPVEIQQTVVIEDGVAKKKVQKKRTIKTRKGDKEQTTEILTLEEEGKKPETIITTEEKP
IAEAEDQLSESIEELPTTVQQMSIIEDGIRKTRRIKKRVIKKRRGSKEEQTEIITVEQEG
KSPQSTVTVEEILVPEEDKPKKKKPKHKKAEEIPWTEQVQLKPTKKPKKPTEKQQMEEVE
LKPFEVPDKEEPTFKVEELPLEIKETTVIDQKGDSKKKVVKKRVIKKQKGDKQERTEIIT
TEEEGKPSETTVTIEELDFLEDKSPIYAIEELPEQVLETVIIEKGIPKKNVTKTRKIVKK
EGGKRETTKIVTTEKEGEQPETIVTVEEDVAPLESETAEPIYAIEELPIEIQETIVIDKG
IPKKTVIKKRKIKKQKGDQEELTEIVTVEREGEKPETTVTVVEEDVLDQFPLKPSVQELP
EEVEQTVIMDQGKPRKKTIKKRKIKKKEGDKEETTEIVTVEEEGKTPEVTVSVVVETITE
VEDTIVLKVDDDKPKKIKPKKHTIEQQQMKPEEIKLKPTQLPQKPEKAEVEEFALPELVK
LKPVVKTEQPDKSEDLEKVILKPVEQPDLMEASIIEKKVKPTKKKKHDVELPEIPDAEKY
IPEVAEKYEFEESPKEQEDIPATPWRRQPKPKVEAEAVEMPGLKLGKGKVPKEENVQEVV
KLKPVKRDKKGDVEIPEKSKPINVEKSEFEPKEFEKIPITAPKRETEDTPKEDEITVIEL
KPTEVTEEEHAPDETTPWRRTPKKKKDEVPEVKEWPRGKRKPLPAEEVEDISLKPIDKVI
PEEPVHKVITEDVKSELAYEVPEGDFTDKLGLKPEDRKEIPEEEVTTITKKRKIKQKDKP
KPEKPEEVVLKPIPKEEIPVELISTKLDDVEETPLVPEVSETEITLMDKEKKPKEISVPE
KPSIKEKEDEEFKRDIDVQIVSKKVKIEKKKRTVKFDDSQPLPELEIISQKRTTEVTDKV
PDEQLTEHTGLHEETTIQTSLVQKTLGKRVKTKTVAPRFIKRVEPVVAEESHPTRLVCKV
EGTPFPEITWYKNEAVFRGNERVFITVVENTVTLEFTKVEPQDVAVYSCKATNPAGVATS
TANLVILEKEESGIAPRFTKPLKPKIVEETAQAILEATVIGQPTPIVKWFKEDEEITPQP
GRQITYDTKTGITTLEILEPSPDDEKIYKVMAQNKFGTAVCRANLIVSKAVEVQQPVIMQ
APKITKPIKAVVAKPSDEVVLEADVEGIPKPEIAWYRNGKEIKPDDKYDITVTENTTTLV
INKKVPKKLKAGKYEVRATNPRGEAKSASTVVITEETSEAKAPRWIKAIKPQIVEEGEVV
ILESIVEAIPTATFQWYIRDTPVTSSPDVRIVTKDNKSTLLISEITPEFAGPITCRAENV
AGSITHTASVNIVKETPWQETEELVYPRFVKPISPISVMDGEKVTFSCVVIGKPTPRVQW
YFNDTPIHEAQDVVVSQDNEGVCSLAISEAFPENAGEYTCRAINKIGEAVCKTSLVVEAY
EYVPDSELGHMTGSEEDLLEDKTISEGLITSDEEEFAPRIIKKLPEVVQTQDGQVTRLEV
KAIGRPKPEGKWLKEGDEILPSNEFIIENFEDGTSILTLPETYPDDVGEIVYEAENPLGV
ASTVTHLLVETVEGIVGTKMYRKPEWVTHMEELSTALKAVHSVPTFVKEITDIRTTEAET
IVFECIFTGTPSPDIVWYHNNKVLRNDNHVKIRIEDNKTTCTITEITKDHVGTYVCKAIS
DIGEATTKGQLFVQEIPEQAKKAILVKKAKEEEERVKKERVTIEKKRELKKKKRASLLTE
EEIKPLDVTEIQSSEVTEEIPLSTTEEAKAKPILDILESVKTEAIASCRKIDEKEEESPL
EKGTAKLSPTEPLRIDEVLAEEIIKDIEKILPQVERARPTTQEGPEETVNITEVKLEQII
ERCEKIIRKSEVKMAREVTHLLELINAKEFGVGQAPLREIAEIVYLLRNGITVKEVTVLY
DDNKFPSLKSPEAQSAMVNVVERKGHGALISEVLTEETTIDESQLAATVGFRAMMKMVEA
NYVSVEEILTNFTPEDFMQRVWEATETVEVPKEVPLQTTISSQVEVHEDTTTKIVKRKSK
KKGENEESLEISEVRERTVQGDKATLSKRHSVEITEIIDTPETGGKTDVEIIEEIDKERI
VKKVLKTRRPHSEEYLIDEEDVDKILPIDFHPQTQLPQNIPSVVSEATHKDEITQIDRDL
EKVKATVGILPLNAISQEQPISQESEQPKAEVTTITQQAYQTGDQFEAYETSEINSQNIP
EHFDSTMKPQAYNADRNITITESLVIEEIYAGDTSITLESKQVSETKAEFSIIEQKASNI
QEVEVHQKEETFKPLEYDQKYPFETHIPKDSSEASSTSQVTQIDHTVEQATADINILPQM
VPIQEKCEADEKEGDHKQSATVLSQASRTIDSVEAFETTEQNVQNQVGEYDKTFKPSFSN
AQPAFSISESINIHEINLGDIPATLSIEGQVEGQAFVSILEQEAKHIQQVDVSDKEKDLE
AFAAPKGVEATKAFITQEGISIEEVQQAMSEDKMDIVKPVGVKPKMNIDTQESLIVEQVL
TGDKPGKYLPQAFVATEVATRSIISQKSITQSHIQAPELEGEYTPGKLPPTQVANENISL
TEGILISQTQTEDREKVFSKSNSPERANALEDILLHESLVVRTVDSQAPQGDITTEETEQ
FTATVDITEKQTVQTESVVAAESENIYEQSQVDTKVATSDFRLLEVSENAFITAHESEND
LAPDEHKTKVLATSSIGPKESLVVEEVETGDSPSEFTDHLKYKTDSAETNIQTTEAQVTI
ETQAGESEMPSEQSQPEAYNIDTTITRTVDEICITENQTMESEKLLEQFETPESQKGKQT
RSHLLPTGISEIVEVDDSESNLKIDNLEQGPASFNQPTFTETVISEAVADEGLNDIESEK
PEEKQASSEVLLQQAVNISEVVADDREKPYKSSDVNTQEATVNITSSQVASQTITDSNIA
PEDLMVSKPVEETAQVDQSTIEHVYTLQHETAEKESEYIKQQPDAKSALFGLTDGLSGPN
VMQVTINEKEDEYSPHITPLEGLGQPNITAHDVAVKTEVELVVHADEIIEDELLTGKAKK
YTKPYNELIVTESNAVDVHKDLPADIHPYSKHANVDILPGQALSVTETRAEQNEEKLTVS
DVDKSNAVVGIEEQQVATKEQIIADNQTGVFDRISPEKQLGITRQDLSHPLVQMEIAAGE
TEGYSSEDIKPNSKQADVLFGEAEGINVSEVFAGEAESNLPQDESPQVDRGNVAISSHII
AVKEEVQPQDSTNALKEEERRTENAKTQFSPLDTIITTESVVGEQESNIEREHRDTQTAT
SEFEEATPISVTSITAAIKETELIKDEINLNQAKQILSPQENIQVDEVLVNDSFTDFDRS
SPTKFIASSVHSQMQSITETELITGEKEANLEKDVQPLQQSAEVEFGEITTAETTETVIS
EKEGKHDTEEATSLVALTSIDAQPVAESSQPESQDQVSSLIEQKPAFANANPETSLIEGL
TQTETLAQESETYFEKPVLDTKSATVDFTSQHAVSISEVKSNETETNLQVEDKPTGNQAT
VGLLGHELPVRSELEINENTGDLQSSQPEHSSAQPEISALSTALQTETITSETEGKSPEA
EKIDQRHVTVSIDEDVGVVVETVTVADKETDLLTERPTTKEAEVNLSESNIIASQSEVNP
NEGILDLEELKPDETTASSSIIFSNTLTQTQQTAIEAETDLADFKKPLSTAAIIGVEAVE
GITSEQTTVAEKEQHLAEFQLPSSKTALQNIDIPGKVAGYETTDIRENPGFFQQSQFEQY
QAQPADEVLHSLIVTQNMSEEKETDFQGEFKPETSTVELSLEKGRIVVNISEVTTEDKEG
YIADLEKPNEQSAIAAIDAVQVPVTAETISSDNTGVSEYQAPQSSSAVLRQDELCQLVQE
SPQLHEREDVFEKTVPLNRKQASVAFDEEQTVETSEVVSAERETAFDKTPAPDTSTADSS
VSGHITAQVSEVQTSDQTSEYIVEKPKETTAGEDQPTFDYLSQGQNLVLEDYLDQDTPDV
AKKTAETKIDEINYLDISEVVLGDAYGKASKEPLLVENAYEQIDEATALVQSHVVPHDTL
TDLTEDVQNTQVVNIVQEMLQSITQSQSNVQDSEKPMDQQLKPDTKQADLNIGEMSSVEI
SQTVSDEKEGRFVPGELPEEKSSLSIMPHHSLVSSEVQSSDDLAQLALISPKETLAEIIR
DELTAISTHEQKTEEKEVPFTDQPAVASTADRTIMPTQSVNITEIITQDSETILHKSIPL
EAQAEESVLLQEATEIRETKSEQDIDLLKIEQPQDYQASLETLPLTSITVTENVSVEKES
EHVKDKSPLLSKADTNLENANKVASISEILTNQLEKDMMPDQPQEGKAVLEFTEHNVIEE
ADANALEALGKYNKDSKLTTSQVHVDLTEARHVASVAEVLQTQAESEFIPGTTKTELASE
AISEHKAIEELQIRCLEALGEKPKAESPESFMAGYVLPDLASAANVTEVLSTQAESEFTV
PKPNQETAHPHLLGLEVVQEQEVRVLESLGDHVRDKLPLSGIADINMEKSNQAVNITEIL
TCSNETELKVQLPSDDFASVTLIEQRNIEETNVKAYESLAKPVSEAVPRTDKAAINLEKA
GKSASITEILPAQMESDLVQDVPNQEKATSNILESKPIEGLDIKSFENVGDDITTKLPDF
SQASLDLEYTRNIASVSEILSNQQESHLESFKAPTSTASPVMDSFKGLKSEDVNVYENTT
EFHRKKHIPQQTAALHKDEFESVMESTITIQGSTQQLEIEHPNSKVADFDMLTEQSITVT
QTMAHGTVGEEISTVMATETTAEKRVEDKPVGTSEDVLTLDSVNVIKPDHVKTLKVQSQY
VDVNRSLVVTEQTVSGSVITLDLETPNQKNVTVALTDTETPQLQISEVQILEHPGEVSED
LPKVIGTVIQDVRESVTIETVMSQKPVEDVPLIEELPEEIEVIEAVAADGKKKKKIIKKR
TIRKRIGDTREDTHIVTIEEEGKLPQSTVTIEEIEVPDTKTDEFLTPSVEEVPYIEELPE
EIIETEVDSLEGPKKKTFKKRTLKKRRGSKVETTEIFTVQEEGKEPQTSVTIQDVTEEES
KLTDVLPEKQEKAVLIEELPEEINIDEVQSRWGPKKRTTKKRIIRKRVGDKQEETQIVTV
EEEGKEPLTTVTIDEIDLPSDKVRPLQILKPDEDVAIEEIPEQVIITTVDTLEGPKKKVI
KKKVFKKKVGDKEQATEILTVEEEGKPPEVSVVVKETVEEEKKVKKLKKPKKATSEQVQV
TEEGYLFVPSLAQEKIKAEGVEDMIQMELLKTALSKQIPSFLPGEDEDEVVEETVSKRKI
KKIIKKKKPKIEDLDIESPLIAEELPEEIQVVETVNKEGIAEKKIIRKRVIKKHKGDIDE
ITTISTVEEENKVPQSTITIEEVEAETEKPSEIDFDQVVIVEEIPEMIELVKGPLEESRK
RIIKKRVIKKRRGSKQENTELIVVEEGDQMPQSTVTIEEIEFPEEIVKKLPDSEEQYVIS
QDLPEQVQLFENEQQKKTVTKKVTKTRKGSKQETKQVFTIEEEGTKPITSTIIEKVDLPE
EFLEKLTIPSMEKAKPVFAEDLDTADIVEVSTKELQKKKVIKKKIVKKESTDQRITEESQ
KPIIAEELPEEIHIIHEEGGPDKIVKKRVIRTRKGNKHEITQIFTVEEEGKSPITSVVIE
EIEYPDEILDKIPEIQPEKSVIIEEIPDQIEVRVVETSEGPQEFITRKRVIKRRKGSKQE
TTEVVVVEENGKPLQSSVVIEEIDIPEDILDTLPEHTEQLEPVIIEELPEEVQVIDAKKT
IKKKVTKRRKGSKQEITEHLTVLEQGKKPQTSVVIEEIEIPDDVLEELKAPTTITKKPIF
VEDVTDQIIVQETQTEEAPKRKVIKKKIVKKPEELPQDVVLARELPEEITVLDEGRKIVK
KRVIKTKKGDKREITSILTVEEEGKEPQTSVLIEELSKEDIQDIPEEYVTIEVTPEETHV
IEEDTPEGKRKVTLRKKVIKKRKGDKQESTEIVVREEEGKLPETSVVIEEETSPDEFVAE
LEPIIIEEMPEQVQVQDTKIVKRKITKKRKGSKQESTLTVTVEEQGQEPQTTVEIYEIEI
PDEVTEKFTLPSVDSKKPYFIEDIPEETVEITETQVQEGPKKKVIKKKITKKDIPKVRPE
SPELIPDNETILITELPEEIKIVTDESGPTKITKKRTIKKQKDGKQEITHIITEEEVGKK
PQTTVTVEVIEAPEEIPKEYPAYIEELPEQIEVEETKSRWGPKKKTTKTRTIRKVKGDLQ
EDTHIVTIEEEGKEPQTSIIIEEKTIPLDLAMPKFEKPEEAIIELPEEIKVIETITPEGV
KQEKIKRRVIRKKKGQKEEQTEIITIEEEGKKPKTTISVTEEEIPIDTVKELVGPTPMEA
SMTYIHELPEEIEEQEIIDDKGKPTKKITRKRVIKKPKGDKQEITEITVTEEEGKPTQTT
VTVEDVPLIEEKVPRKKISKKKEIDKPKKLRREVSVLLPLVIKEVKFEKVKIVDAKDVPL
FGEVKLRKPKKISQKKDTTTKVQIPRLKSRINHITFPPLTEIEQLPRISILEPIYRDNGI
LSRNIKEAEKLPKTKRRRLRDKDVIGKSLEKLDLELEDLKKKELEKLDDEYKFEKKPRKK
PASKEELQPIKLGKGSVEQPSEDDETVKLKKVPLKPQDIEEQTELKPVKKPDTIKKKDKK
RPEKDSEKIVFEPYDVDYEQPELDKYEPTKPKEEEEDKTVPKKVKAVRKNKDKQAPETEP
AIIEPGVPKTIEGEEQPEVTLKYARKPKPEEESEEIRLKPHRKLDDDEEFKVEIDQVMKH
DAIITFEGPDIEQDIKFDDDTEKPQSRKVVKKIKKKVQKGQSDLEEIIPQDAEVLTVEEE
VVEDIPQLQQPLELNEIEIPEIIPSEEDKSAIKKKKKTVIKRRPRKEGSEEIAEQSEEFP
VSEEEELQVEEKEVKIIKKKIPKTKPEETPSQAPEEKLEKPKDIEDQKPVETPEKKKPKR
VIPKKEEVKEKIPRLKSRIVHVPFPPENESERIPEITQLPPVYRDNGILSRSIKEAEKLP
KKKKIRIKDYERDLKDLEKLDLEVEDLKKRELESLDKDLFAKPKKTKKSEKPAAPKKLEI
GKGEIPDKNKPDEEIVLKKVPDKLIKEDEEDVKKPKSKEKKDRLVAPKKDERNVEGTPFE
PYDIERESPDKEVLELPEHEEEEDIPKSKETVKLPKRKKVKPTPESIEQELKPGIPKPKE
VEEAPEITLKKN
NT seq 62679 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaacccagtctatcttgccttgaagcaaccacatcagtaatccttccgggt
ggaatcgataaagaaggacgacctatatttctggttactgtaccaacagatacaacttcc
ttagagataaccactcctttgaaatatttgctttctattttcagcaagtcgtcaaaaaga
gccggattcacggttttattagatgcaagaaaaggttcttggagattgtccagatcatgc
attaggcagacgattgacacgttcccagaaggggaacttcgaaagttggttgtgttgaaa
ccagatggattttgggataaacagagggtggagaattgcaccgtaccacaaaaagatcaa
gaagtgatatttatcccaagatctcgtttgaacaagttcgtagatcagtcgcagcttcct
gtcgaactggacggtggattaatttatagtcatgagaaatggatcgagaacagacaaaaa
gtagaagaattttacaaagacgccgaagtgacaataaaagaactggaagaacttcgacaa
catgtgatacgaagtaaagcacttagagctagccaagtcgaagaggccattaataccagt
tacgatatggaggaagccacaaaaatgctcgtacacaacgcaactgaaacaggcaaagaa
ctggttcaaaacattgaatatgaaaaccgcactaggaaattatcggtagaccatattgac
cagacatttacacctcaggatacgttagatacgatagaacgaatacatagcatagttaac
gagataagggaaaagcagcaggaaattgagacgaactggaacgagatggaaaaaagtcta
gtcgataccaaagatttaaatgaattgaagaagaaagtcgtcaaagtaacaaattggatt
ttaggccctgctgagcaattgatgagcttcaaccaaaaagtgggatacgatgtcgcatca
gcagaagagctgagaagagatcatgaaaccatcgagctgcaatgctgggaaacatatgga
gcatatgctgaactgcttcatcgaattaacagcatgtctgaaagtgcagatgaaaatctc
gtcgctcagcacaaagatttgatatcacagaaggagtttatggattttgtctgcaaaagt
ttcgccatgagggtggaaaagcggaggaatatccttataacgtccctgcgattcttcaga
ttagtgtccgaatatttcgacaaaaccggagaggtatttgattcgttggtcatggggacg
gatatcaacgattttgatgctgcagcttttaaacttgatgagttgcaagaaagtcaatca
tatctggaatcggttgaacaagaaatcctccgagaaggagaaaagttgtccgacatgctt
tcaatgccagtcaaagatgctcttggacaagaaattgaagctgactacagcgaagacatt
gtgaatatccacgacgtcttagatgccactgttgcaagaaaaaatatatttagtgatagc
gtggaactgcagaagttgacgctgcaacaaatcacttttatagatcgttacgagaaagac
gctgagcaggcgattaactggttgggggacatattgagagtcatgctaagggactatggt
catgttggatgtactgtttacgagattcaattgcaaaaggatgagcatcaagcgttccaa
gagacagcaaagtgcacatataactacggctgccagctattgaacgcttcccttcaactg
cgccagtcttgcaaattacccatcgaacctcacagtaacatgttccacattttgaggaac
aattgggacaggacgcaatcaatcagtcaagaacaaatgaccaggttgcgagtgtcagca
gttttccataggtcaatagaggagcattgtaatcagctgcgtgatttaagagaagctgta
gcgacaattcccattcttagtttagcaaaaaggagattgaaagtgcatcagtattttgac
gacagggaaaagctgatggtggaagttggaagaatggtgaggctgggccgattgcttaga
agccgactgaaggagccactttacgaggaggaatcatttttcactcctgcatctgttgcc
aaccacatcgaagacgaattccaaaagctttgcaacaactcgataaaaaataatgagatt
gctatagaagcgatttcggagagactctcagaagtaacgcaactctcagaagagcttgac
caagctttgaaaagcgctcagcaggattgtatcgtattttctacaacatccacatctacc
agtactgttggggaagttaataataattacatcgatcttccgaaaattgacattagcagc
atggacaatgagaataaaccttttgagaaagtgaacaagacagacgatcagcttcgctca
gacgaagagttcctaaccgcttctgacactactctgcagcattcgcgctcttcctcctat
aacaccgcctcagaatgcgagcaacacttttcgtcatggtggcagcatggaaaagacgat
atgcgagagaacgtttccaaggagaaaatggttctggctgttggatgtccacccgaagga
gaactccctccctcaaaagaggtgttgaagccttcaccagaagttccaccaggaaaaatt
gtcagggaggtcacagaaacaacgcatatcaaggttcagcagagacataatttgggtgtt
aaatcttttgtgctcacatcagaaatcgttagggaaaaggactcggaagggccaatcacc
actagagaagaaacagtgaaatatcagactgaagatggaaaagaagtgacacacaaagtg
gataaacctggagctaactttcacccagatgatctgctagctagaataaacgagtgcgga
gattggattcaacttaaaatactcgaaattacgccagaacttaccaccttgggaaacaca
ctcgcagaagctttggaacttcaaaaggcacataatgaagttctgcgacagcttcaaaac
aagcaaagtccggtggaagaacttcttaggcaggccgatcagcttattgccactcaaagg
ccaagagctgaagtatatgcagctatggcagaatctttgggtagagcatggagagatatc
aatgcaactttggaactgcgcaagctaatcctcgatctcaacgttcagtatcacacaaaa
gcagaagagttttttggaaaaaatgatgccctcgaatcagcctgttcagattcgaatcta
ccaacagacattgatgcagtgaaagcgctcttaacaactatacatgacctaagaagatca
ctattagagacactgatgggggcacttcaagcgggaaacactctattgagtaaacttaaa
gaactgggagctgaaggcacactcgactcgaggcccgaacgaatacgatcttctgttagc
aaagcaatatcacaagtccaaggttggttggacgagctgcatataaagaggcagattttg
gaagtcacttttaacagaagaaaagtgcagctggaacaatgcttggcactagcattgcta
gcatccgacttaaaagagctagaagaagtgttgaatgataggagaaatctgcttgcaaat
agcacccaactcggtgattcttcttctagtgctgaattgctgcttcatgagcataaaaaa
cttttgccagaagccaggcagttgcaagagcgagctttaaaaattactaaagctacagag
caactaggagcttcaggctattttgctggagatcaagccactcaaaaatcttatgtaatt
ttgtcatcaacttctgactacttggccgatctgcagcaaagggagatgcttttggaacga
gtgatcaacttcttcagagcatctcacacagttcttaccaaactagatcaactagaaatt
caactgaaaacaaccgagctgtcgagaagctcgccaaaactggccgagctgcatgcgcaa
tgtgccagaaccattgaagattctaccgctgcaccaattgcagaaggatacggaattttg
gaactagctgcccatggaggaggcaccgaaggagtgaagaaaatggttcaggaacttgaa
aacatgaagattgttttgaacagtctttgtacagctcatagggaggaaaacaaacgaatt
acggcagctttgaataatttcattgagcggcatgatgagatttacaactggctggttacc
attgcagaagcgttcttgcagggtcatcaggatatgggtggagacttgcgattggctgag
gactttttgcagctacacaatcgcttgcaggtggacttacaaaccaaaggaaatgaaatc
aaccaacttctactcactctaccccccattttggagtacttggaggataatcaaagaata
gatgtggattcaaaggtagaagggctccacaaccgatggatgaagttgaagaatctgtta
gaaaatcggctggatttggcgaggatttatgtgaagttctttatggaagttgatatcgtc
aacagagaaatggacgccttagaagactccacaagaggtcgggagagtgtggatgaaagc
actatgagaactattgaagagaaatttgagttgctggttccatatttccaatcggctaaa
aatactgggctaaccttcatcagcgaatcccatagaatctctgagccacatctcgacacc
caacgggctcgaaagtacgtcgaatcggtgctggaacgactttctggacggcaattgaat
gtgaccaaatcgtggcaaactttccgcgacgaagtggtagaaaaacgcgaaattcttgtg
agacttgaaagaataatggcagagagtacaaaaacaatcagttgggtaaccaaactggat
tcccaactgtacccaataatcacgacttcttcgaccaatccgacggaaattgtcgccctt
ttagagcacaagctggaaaacgtgcttccagatattaaaaaagcccagcaggaagtcgga
cagaaaatcaaaagcgctgaagaactcgttgctaaagcaggcgctgccgacgaaaaaact
ctgggtattaagaataaacttagcgaactgagtcaaaagttggtggaaatttcctcggag
tatcaaattttactacaggttcttattggctattttaaaaacctggaggagattgacaaa
aaggctgaaaactataatgctcaactggaacacattcgcttacccgacgatttgcaagga
attgaatcggtacttagagagtcagaagtaacgcgggaaactattttggaacgattccga
tttgcgcaaactgagtgcgagcaaatagagcagagaattaaaaaccaagaacctaccgag
gctgcccagcatgatattgaaaaattacaacatgtgctggaactcagaacatcagaattt
gagtgtcagtggcgcgaaactaatgaaattctcagaacctgtcgaaaggttagcgaactc
acgaaggaaactaaagaagtaagaaataatatcaacgaagtcagaagccaggttacagaa
ctacgaactcaaggaggagactcattgagtgcgtctaaagcagcttgtgataactttaaa
caatttactagagtcattgagactcttgatcttcgtataatcaaactgaaagatgaaagt
aagaaacttgaagaagaactaccagcggaagcaccgcgaatccaaagtgaagtccgcgaa
ctggagtcccaatggagcgatgttaaagttcaagtggaagacactaaagtagttctcgat
aagaacgtgaagtacttcgaattaattaacgaagcaaacgattggtacagagaagggagc
aagctgctggttggaatagccagaaaatccaccgctgtcaaacagcccgaagaagccgag
cgcttattagaagaaataagctcctttcgtcagccgggtgaagaacgccaatcggagaga
attcaggaaatatccacccttgcccatcaaatttacggccctgatgaaagtaaacacgct
cctcttataaacgcaaatcgagaaatgctcgaatcattctcgtctatcagcaatgaactg
gctcagctttccagcaatctaatatccgcagaacaggaaaagcaacgcattctaaaagag
caagaagaagctcgcagagccgaagaagccagacgactcgaagaagaacggcttgctcac
gaacggcgacttgcagaagaacggcgtctagctgaagaagctcggttagctcaagagctg
agaaaggctgaagaagcgcgattggtagaagcaaagcgcttggctgaagaaaagttgcgg
gaagaaaaagccaaactagcagaagaagctcgactagctgaagaaaaacgcgcagctgaa
gaaagacggctcgcagaagaagcaaagttagcggaagagcgtcgtagagagcaagaagct
attttggcggaggaagcgaagaaagtggaggcagcaaaacgcgaagttgaaaagctgaaa
atccagcaaattcaattcctcgaagaagctaaaagagccgaagaagaacgacgcagaatg
gaggaggaagagcgtcaacagctgcaaaaagcgcgaatggaagacgatgctcgcagacta
gaagaagccagaatacttgaggaacaaaaccgactggcacaggaagcaagacttctagaa
gaggaacgtctgagggaaaaacacaatgaactagaagctgaacgtcaacgcttagaagaa
gaaaaattgcgagcagagaaggcccgaatggaagaagagcgaagactagccgaacagcga
caggccgaggaagagcagctgaggtcgcagaaggctcaaatggaaaccgagcgacttcga
gcagagcaggctagattagaagatgaagagcgcagggtcagacaggcacaattagatgaa
gagaggcggaaagcggaagagcttcgactcgatcaaatgcgaaaagctgaagaaatccgt
cttcaggagatgcgccaagccgaacaaactagattggaagaagctcggaagcaggaagac
gcagatagacagaagagattggaagaagagatgatcaggattgagcaaactaggatcgaa
gagcaaaagagaattgaagaggaaatccgcaagcaacattccgtgcaaatcaccgagatc
aaagaagttcataaagtggagtctttccaaaaagaaaaaagtcccatggttcaggaaccg
caagaatcaccagtattcattactcccctaagtgatattgtaatccaagaaggctccaaa
ttgaccttcatatgccaagtaactggccatcccaaccctactgttacatggtttaaagca
ggtgtcccaattcaacacaatcctgactatcatacttcgttcgacaacggtatttgctct
ctaactatcgaagaaaccttcgcagaagattcggctaaatacacctgcaaggctagcaat
tcggctggaatagctgaaacatccgcttccctgatagtgaaagaaacagaaccagatgat
cagcttatggcaccaacatttgtcaaaatgctacaacctggagtggccaaagaaggagcg
gaatttcagtttgaatgcagagtggaaggaaatccgctcccaacagtgcagtggtttaga
aataaccagtgtatcgacagttctccagattattctattacatataataatggagaggct
attctgagcattgacaaggtttcttcggactataaggcagattatacctgcaaagccacg
aatgatttaggcacggctcaaagcactgctaatttggtggtgacagccctggaacctgcg
gaagctcccgtttttgtaacaccgctttcaaatgtgatggcccgggcgggccaaaaaata
aaattggagtgcgaagttgtcggtctgccaccgcctattctaacctggtcgcacaacggc
aaagctgtgaaggaaacgagagaaactaagttgcaatttgaaggaaataaagccactctg
gtagttttggaagccttcccgaaggatgccggcacttacacagtaaatgctaagaacata
gcaggagaggcttcgtcaacttccacagtttcggtcaaagggcgacttccgaacgaaact
tccgatagcgaactggccagcgatatggagccggtaaaaccgtcgattcaacttccgtta
gccaacacaaccgttaaagaaggcaatcaaattcgattagattgtgtcattgttggacaa
ccggaacctgaggtgatttggtaccatgatggtcgcccagtaaaagaatctccagatttt
caactacttttccaaggagaccgttgttccctagtcattcaagatgcgttaccagaagat
gctggagaatataaagtggtagctttaaattcagccggggaagcatctagccaatgcgtg
ttggcggtggagcccaaacaagccgaagaaccagttgaaaagcccagtggaacaccgccc
aaattcacaaaactccttaccgacatcctggtttcggaagaagacaaggtcgtgtttgaa
ggaaatgtgataggagaacccaagcccgagctgaaatggttgctcaacaacattgctatc
acagatacggaacacttcaaaactcagatagatgattctggaaacttcaagctggaaatt
gaaaatgttaaaccggaagataaaggagtttacacggtaaaggcgtcaaacgacgcagga
gaagccaagtgctttgcccagctaatcgtaaaatcttccaagttggccgaggcggctaag
ccatacgaagaagtcaaatctgcaccggtgtttaaagaaatgttcaatgaccgaatagcc
tttgccgatacacccacaaagtttgagtgcatagtcgttggaaaaccgaagcccaaagtt
aaatggctctttaatggcaaccccatttcgggagaaggcgttttaatatccacttcagga
gatcgacaagttctgagcatacccagcttgaaacctgagaatcaaggaaccattacttgc
gtggctgaaaatgagtcgggcaaagcaagctgcgcagcatctctaacagtacagtcaact
tctgaaattgccctaccagagcaggtgttgcctacaacatcttcattaattcctaccgat
attaagcagcatgtagaaacatcctattcagtcaatcgcgaagtagttactcaatcatcc
acttcatcatcgagcaagctaatttcctcttcaataagctccagtgaaccgcacgttgaa
gaacataaaaccgtctctcaagaatcccaatcattcaagcaagtgaaccaaggagcgcca
caaactcaaaaaaccactcgcattgaagaatatcataaggtgggaaatgaacctccagtc
ataacagagaagacctatatttatggagaccagagcgactcaagtaatatcaaggaaatg
aagagtgttgatcaaagacaaattattaccaagccatccagaatagtcagggcacccaag
tgggtcacaccagtgattggtaaaatagttgatcaaaacgttgatgtgctactggaagga
atcctggatgggcagccgattccaaaggtcgtatggacgaaggatggcaaagagctggtg
gaagatgaaagaaccaaaattaagttcgccctcaataaagcgacggtggaaattaaggac
accaacgtgaatgatgcgggcagatacagttgcactgctacaaacgatggtggaactgca
atcagtacagccgatctggttatcagaaaaacaatatttcctccagtgtttggaagacgt
ctgcaagcgcaagttattaagaaaaacgaccgtattatcatggaagtggaagtcactggc
actcctgaacccaccattacttggcttaaagatggcattccaattaaagacgcgttaagc
gacgccaaaatcaaatccatgggccacagccacactttgaccatcgataaagctgatctt
aagcacaatggtcgttatatgattagggcagtaaatacaggaggagaagctcaaagtatt
gctgatatggcggtctacgaacccacgccggacacaatggttgaagtagtgaagacggtg
gtgtttgaagatgttaagaagcacgaaaccctggcatcaacagccgacagaacatcgtcc
actataagtaccaaagcgccgctggtgcctactaaaatagaggtggcaccgttgagcagt
gaaatatcccaatcattttccaaaaaatctgaatccacatcaactgtcgagcaaaaatcc
tcccaacaatcgcatacttataagctcgaacataaaactcccgaaattcccttgccgaag
cccatagaacggaaaacacctacatttgaaaagcgaactgactatgaaatatcccatgaa
ttcgttccgggtgagaacaaagaagtaatcgaagagaaaaaaacagtgattgaggaggga
ggcattgagaccagctccatatccaaacaatcttctctgcaatactttgtaaagaaaata
aaagagggcgatgctgcgccaaccccgaaagaagtgccagtagaaccaattcaaccacta
aagccagaaattttccaaaaattcaccaccgttgactcagaagttaaaaaagaaactgct
gctcctactaaagctcctcctgtatccacattcactgaaatcagaacaattgacaataaa
tcaacagcgccaatcactcaggaattccgctcggtttcttcaacaaaagaagtaacacgg
gaggtaaagactcttcctttcgctcaagaatataaaagctcctcctcgactacagaaaaa
acgtcgcatccatttagagaagaattccaaagagaaactacaaaaactcaaccaacgagt
aaaccattcactcaagaatattcttcattctcttctagacagcaaatttctgcaccacaa
gaatacaaaacctactcttctgaagtgatcagggaatttgaccttaaacctgaacctcct
gcagaaatttgcttcccacctactaaagaaccgacctttaagcaagactcagttcaggaa
cgtgtgcacaaattatcgacaagttcaaaggaattgcctgctcatgaagttcctcaggga
ggcgtcaaaattttccctactccacagcccgcaaaaactgcagagagctttagcgaacga
aaagaattttccgagaaagtcgaaaaatcttatcagtcttcctcatatcaaacttcctca
tcctcattctctaagagctacgaatccagttcatctccagcttttactggaaggaaaaca
cccgaagtaccttcagtacagaaaatttggtcaaccaaacaggagctattcgatagaccg
gcttcagtcgcctcttcttcatactcaacggagagacattcctacagcaggcccttgtct
gctttgtcaggagaaccatcaacggaagcgcttcagatggaaaaacaatgggcccacaaa
ttcatggagccccaaaccgacaagccttggacgcggccccaatcagcagggccgaaacca
acttcatcgtggagtacacaaagcacattggagaaaagatgggctccagtcgaaatgaaa
tcggagaaaattgtacaagaaagcaggacttttttaggcaaaactccagttcttgtacct
cactatataggggaagtaacacgactggaaacaacagtaaaagaccaaacaagtgattca
tattcaagctcaaagtctgaacacattgtggaggaaagtaacttgaagccctcactcaag
tcttggccgcctggtccacctgttcaggaatatgttccgcctccacctcgaccttatcca
accattgagtctatccgagttagaccagtatcagttcaggatataaccgatgaggtatat
ttagaaccggggcctcctcccgaaattggatacgctgagcctcctacagggcgaaggaga
tcttacgtggaaactatcgaacacgatctgaagcaggaactgcaacgagaacccagcaag
gtccctccatgcgcagtacgaacgattcctccaccgcccttgccaccaaagaaggaaatt
cctcaggccccgccagttcctgccagaccaattaaacaagtggagacaaaacccaagaag
ccactcaaagaattgccttatgtgccctttgaaaagtttccagacttagaaccctttccg
ttcaagcccgatccggatcgaccaagacctccaagaactggacctcctccaacaccttcc
cgattcgttaaaggacgatttacagatagtgattatgagagtgactttgagaatgtgcga
attccaccgaagtggaagccttcgatgagcgacactgaggagccacgatatcggcgagtt
cgagctcctcttttagttgccactggtaggtcacgatctcaagaacctgagcctttacct
ccctccaaattcgatagacctccacaatttcatgggccaccaagacctgaggtggatttt
gaggagtttcgacgcaaaaaagatgcatcacaaattaaaaagatgactaagcactttgag
caagttagaagggaagtttctcctccaaaaatcaagcccgccagcccaccgacttacgtt
tatccagagaagaggcctgagtcaccgaaagtgaaaaagaaggtggttattgatggctac
atggctgataccgatgagcccttccagcagagggtcatcaaaactgaacatttcagagag
gagaaaaccgagtcccgccatatatcccaatccagtcagaaaatctacgaaagctcctca
tctacccaaaaaactttcgttcctaaaacccgcgtctgtaaataccccgccaagaagcat
cagtcgtcagtttcttcagtcaagaaggaatttgtagctactcccattataaccagccaa
tccactcaggaatatactgaggagcaccagaagcagactcatctagaatcatttccctat
caaccagaaccacccaaagtcaaatcgactaaagcgcctccaccgcccagtccttccaag
tttattaaaggagaatttcgcgagagtgactacgaaagcgattacgaaggcagagttccc
cctatttgggggcaacatgttgacaaacagtataaaccagtgaggccagttttgactcca
actcatcccaattatcagccgcctgctcgcacaccaacaccgcccacggaatttgaaaga
cctccagctgttgagggacagccaagacccaagttcgagcccattgaaaaaattactcca
gtccccaagtcgatagttaggaaaccgaaagcgttagctgcggctcctataacggactta
gttgttgctactccagccgttcccatgaagaatgtttatattcaaccaggatctcctccg
gaaattggttatgcgccgggaccaaggaaaagccaattttatagctcaactacatcagct
ccatataaaaacgctgtccaaactgaaacctccaacattgttcactttgatgaatccact
gatacttgcaaaagaacgatgagcgtgcagcagacgcacaaagtaataaagtttggagat
caatatcggaaacaggaaaaaaccacccagcgagaatcgtacccatttagtccggaacca
gatcgctccagacgatcgaccagcgttcctcctccaccaactcccagcaaattcattcgc
ggagagttcagagaaagcgactacgaaagtgaggtcgaatccgcaaaaattaaacccaaa
tggactccaggcggtagtgatgccgatgcattacattacaggagagtgaaagcacccaca
ccaacatcagactattcagcatacagttctcagcagcagagggcgagggccccaatggaa
tttgatagcggcccgattcaatctactaccactactattacggacattactgatgaggaa
atcagtcggcagcagttgaaaacttcttctgaaagctccacgaagcagattttgagaaga
actaattcctacgagcctccaagcgcgttgaaaccaggaacaccgcctgaatacggatac
gtctccgatcagcgacttacaaaaacgtcagcaaccaaactagcttctcaacacatgaac
agcatgaccaaggacttcaagtctaagactcagcaattcgttcaagacattatgagcgat
gttagcaaaaagcagcagcaaacatccaatgcgaaaacggaaactgatggagatgcccaa
gtttaccgagaagaatcgagagccatgagccatggaacaaaacacgtggatccagataca
ggactaatttatttcaaatacgatttcggctacgagttcggaattgttttaccgggagaa
tcaaagtctgggggaattccagtgccaaagaagacagtgatcgaacctcctaagagaacc
gtggacattgacatgcctgtttaccacgaaacatcaaacttgaataacgtaaacagctcg
aattcggccccaacgccgcaattcaaaccgaaaaaattcacaaacaaatgggatccgact
tcggagagtgaaatgtcagaatacgaaggcgactccaagaggaaatctggattgtctcaa
ggttcgcgatgggaaccgtcgtcgtgtagtccgtactcgctgtctcctagtctgcctagt
acttctcctgcttttaatcatacttatgcagatcgggttggcgcgcagactccacccagt
cgcccaaatacccccggtgcgaataaatttattatccaacctggacaaccaagaccgcca
ttatttataacgcctttacgtgatattgcagttgttagtggccaaacagccaaattcgag
tgtatagttcagtcggaaccaccccctaatattttatggtcgcagaacgggagaatcctg
gagaactcaaacgatcaccaaatccactttaggaatggtgtttgccgcctaattattaag
caggcttacccagaagatgctggcacttatactgttgttgctagaaatgctttaggtgaa
gctcaagtctctgctagtatggtggttgaaactcgtgctagcatcgacactagaagcatg
cacaaaggagcctatgacaaaactcaacatctagaacagtcgaaattcgttgagccccag
tatcagattgaagaaatctcaaaatcgaagcccatttttgtcgtgccgctttcagatcct
caaccctgccaagaaggccgcaatattcaccttgagtgcaggttggaaccaatgggagat
cccaccatgagagtggaatggttctgcaatggtcggcctgttatagtcggttccagattg
agaacttataatgactttggctttgtcgcattggacattctccaaaccacagctcaggat
tcaggtgaatacacagttcgcgctgtgaaccacttgggatcagcacacacttcagcatgt
gtaagagtaatagccagctcagacatcattactgacactcaacatgagcaatcgttggaa
caaatccagatgctagaagatgcatcacgctaccgaaaacacgttcaagaggatgtaaca
gtgcttcaggccccccaatttactagacctttgcacaacattgaaacagtggaaggaaca
aacattcacatggaatgccgtctgcaacccgtgggcgattcatccatgagagtcgaatgg
ttctgtaacgggttcccagtgaaaactggccaccgtttcagacctgcctatgattttgac
tatgtagccctggacttactcagcgtctacccggttgactctggcatatacacgtgccag
gccaggaaccaactaggcgaagccgtgacttcctgcagtgttaaagtaattgccaaaaaa
gacttgcttttcgatagtcaacatccagccggattggaaaagatccaacacctggaggat
tcatcgcgttacaagcgtactgaattcgtcgatgaacaagtgacagtcaaacccagattt
gtgacaaaaccaaaaagtcttgaaaacatgaatgaaggccagcatgcccactttgaatgc
aaaatcgagcctgtaaccgacacgaacctcaaagttgagtggttcaaaaacggcagacct
gtgaccgttggacatcgattccgtccaattcacgacttcggctatgtggctttagacatt
atcgacctgatcgctgaagattctggaacctacacctgccgagccactaatttgattggc
tcagatgaaacaaactgctctctgagatgtagacaatccggccaaattattacgagcact
gtgaatgaaacaggcttgcagcaaattcaacatctcgaggacagatctcgataccaaaga
cgggaagatgtggaggaaatcaccactcaagctccaatgttcacaacatctttgaagaac
attgacatcaaagaaggccaaagagcccacttcgaatgtcgcttgattcctgtatctgat
gcaacaatgaaggttgagtggttccacaatggacaaccacttaaatctggctccagattc
accgaaacgaacagcttcggatttgttgcactcgacattctttacacttatccagaagat
gctggaacgtacacctgcagagctaccaacgctttgggcgaagctgttacatcagcaatt
tgtaatgtgcaatcgaagaaatcgctttatctggaatcagtacatgaaggcgctttacaa
cgcctcactgagcttgaagattcttcccgttaccaacgcaaagaggttcatgaggaaacc
attagccaagcgccagtattcactgtgccactcaaagatctgcgaacagccgaaaatcaa
gcggcccactttgaggcaaggctaattccagttggagattccagactaaaagttgaatgg
ttgaggaatggtgtggcaattcaagcgtccaaccgtataacaaccatgcacgacttcggc
tacgtagccctcaatatgaaatatgtaaatccagaagattctggaacttatacctgccgt
gccgttaatgatctgggagaagctattacatcagcagtacttgatgtgaaatccaaagct
tctctgcagttggaatcccagcatgaaggtgccttacaaaaacttcgccagcttgaggat
tcaagccgctatcaacgccgcgaagaacaagaagttcaagttacccaagccccattcttc
tctacccaacttaacggccctactgaaatcattgagggtcaaagcgcacactacgagtgc
cgcattgaaccctatccagactccaatcttaaagttgagtggttccacaatggtaaaccc
ttagctactggacacaggttcagaaacgcctatgactttggctttgcaagtcttgacatt
ctcaccgcctacgccgaagactctggtacatacacatgcaaagctaccaatttaatcgga
caagctcagtcatctgtacaaacttcagtcagatccaaagcctcaatcattcgcgacacc
cagcatgaaggtgctttagaaaagatccactacctagaagatgaatcaaagtacagaaaa
gtaactcgcgatgaggctgtcattcttgaaaaaccacaatttggaagaggcctgaaaaca
atcgaaaacctaccagaaggtcaaagtgcccatttggaagcaaccctcacgccggtaaat
gatcctacaatgagagttgaatggttctgcaacggaagaccgatccagaccggccatcgg
ttcaaaacgacttacgactttggatttgttgctttggatattttgtatgcttacgctgaa
gactccggaacctacatgtgcagagcaagaaatgctgtcggtgaagcagtgacaactgct
gcagtttcagtagtaaagagcaaaaacctctacttggaaactatggatgagcagaggctg
aagaagctcaaagaacttgagacatacgaaagacccaagagagaagaagtagagccattg
ccacaaaaaccggtattcttgaccccactcattagcttggataacttgcaagaaggtcaa
cacgctcacttggagacacgcgtcgagccaatcaatgacgccaaccttaagatagaatgg
ttcgtcaatggagttaaactgaaaactggacacaggttcagaactacccatgactttggc
tatgttgctctagacattttatatgcctatgctgaagacagcggcacttacatgtgcaaa
gccactaatctagttggtgaagctgttaatacttgcaccattaaagtaggaggtggacga
ggcatcttgcttgatactcagcaccccgaaggtctgcaaaagatcagagaattggaggcc
caaggccatcctaccagactggaagtggaagaacccgttccaactgctcctagattcatt
actgaacttcgtggtacaactgaaatttatgaaggccaaaccgctcactttgaggcccaa
gttgagcctattcatgactccagcttgaggattgaattctaccacaatggcaagcccttg
ccccatggaaacagattccacattaccttcgattttggatacatcgctctggacattact
catgctgtaccagaagacgccggcgaatactccgttaaggccataaataatctaggccaa
tgcgtatcttcaatcaaccttcgcgtcatttccagagacaacataataactgaatctcaa
cgaccggaaggtctggacaagatcagacagctggaggctcacgagccataccgtcgtcca
gaagtggaggaccaggttacaagacaaagaccagttttcactcaaccgctacagaacatt
gatttcatccgcgaaggtcaaaaggcccactttgagggccggctgatcccagtcggagac
ccaactttgaaggtggaatggttcagaaatgaaaaacctttggaggacagctccagaatt
agcaagctgcatgactttggctatgtgtctttggatatacaacatgtgagggcggaggat
gaaggcatttacctctgcagagcttcgaatcctcttggggaagccgttacaactgcatct
atgaaaattagaaccgaagccaatatccaattagatacccaacatccagaagctcaacgc
aaaattgctcaattagagcaaccactagctcctagaccagaagctcccgaaagaatattc
gaaaagcctattttcacccaattgcttactggtcctacagaactttgggaaggccaacat
gcccacttcgaagctagagttgttcctgttggagacgctagtttgaggttcgaatggtac
gtcaatggggtagagcttaaacttggatcaagattcaaagtaacccatgactttggattt
gtgactttagacatcttgtccactgtgcctaatgactctggcgtttacacttgcaaagct
attaacaaatctggcgaagcagtgtcatctatttcaatgaaggtaaaatcgcgctccaat
atcattggagagccactgcatccagaagcatgggaacaaatccgcctgaaggaagctgaa
atgaacaaagtgccagagatgttcgttgataccactcctcagcaacctccagtgtttacc
actcacttaaagagctatgacaaactggtagaaggacaacatgtctacctggaagcccaa
gttgagcccagaacagatccaaacctcagaattgaatggttcaagaatggagtctcactt
tccactggtacgaggttgcgcagcacatttgattttggcctggtaacactctcaatcaat
ggattgcgaggagatgattcagcaatttacacatgcaaagcaaccaacaagcttggcgaa
gccatatcaacttgctcgttgaaaattgaagataaagattggcttttgggacatagcttg
catccagatgccatcccgaaaattgaagaactggagcggccacaagcacctcgcccagga
cttcccgagcccacttacgaactgcctatgtttatatcccatcttaacaacgtagaatgt
ttcgaaggcgatagcgtgcactttgaatgcaatgttgagccatccaaagacccaactatg
aaaattgaatggtttgtcaacaacaaacctcttccaactggagcgaaatataaatctacg
tacgattttggatttattgctttagatattacccactcgtatgaagaagattctggtgta
tacacttgtaaggccagcaacagcaagggttctgcaaccacctctggaacacttcgctgc
actggaaagaagagtatttattacgatacgcaacatccacagggacaggcaggtttggag
gcaatcgacgaagtcgatcaagcattcgcagctaaagctaaacatccaggctttgcagct
gacaaagagtttcccaaaccggtatggaccgtgcctctcaatcccgaatttacagtactc
gaaggaaaaccgttacatctggaaggatcagttgagccgaaggaagatccaaatctgaag
atcgaatggttcttcaatggcaaatcgctagatcacgcctcaagattcaaactcaccagc
gactttggattcgtcactctagacctgactgatgtgtatgaaagagatcaaggtgtttac
actgccaaggcttcgaacaaagctggtgaagcctttacgtcaactacaatttattgcaca
acgaaagccaatcttattgagcgcacccaacatcctaaaggacaagaaggtttggagaag
atccaaaatcttgaggactcgctgaacaggcccgaaatgccgttccttgaaggcgaagaa
ggccatgccccagtattcacttctgagtttaccaacctgaccaacctaggagaaggagaa
attgctcactttgaagcaggcttaacaccaattggtgaccagactatggtagtcgaatgg
ttctacaatgagaaaaccattgaagcctcacataggttcagaactgtacatgctttcgga
atggttgttctggaagttttgggagttaagaccgaagatagcggtacttttacctgcaga
gctacgaacaaatggggtatggctgaacaaagcgtgacacttgaatgcgttgaaagggaa
gctggccagaaacccaaatttactacccatattcaggatattgtcggacttaaagatggc
caatctgcacactttgagtgcactctgatcccaattaacgatcctcaacttaaggttgaa
tggtaccataatggacaacccatattgcattcatcgcgtatcaagactgtgtccgacttt
gggttcgtggttatggacatttcgtacatacaagatcaagattctggagaatacgtgtgc
agagcttacaataaatacggcgaagactttacgcgggcaacaatttccgctcatggcaaa
ggaggagtattttcggatagtttgcaaccggactctctggctaaaatcagagagctggaa
agcttccagggacaacaagcccaagcaccaacatcgccagtcactgaaccacctaaattc
attacccaaattcaagatatcaccaagcttgctgaagggcaaagtgcccacttcgaagca
cgcctcacaccagttactgatccagacttagttgttgagtggtattacaacggcaagaaa
ctaccccatgggcacagataccgaaccttccatgatttcggaatcgtcattctcgacatt
ctctactgctatgaagagaactctggagtctatgaatgccgtgcttacaacaaatatggt
caagacgcaactaaagcaacgctgaaatgcacatccaagacgaacctgatcctggactcg
caactaccgcggggcatggaaggtggattggaaaagatccaaacgttggaggattctcta
atccgtacacgagatgaaaaagaagaagttaccaaaggacgagctccagtattcactgtc
ccgttatcaaacgttgacagtttacgcgaaggtgaaaatgtccactttgaagccagactc
atcccaactgacgaccctaagctcaaagtagaatggttctggaacggcaaacctcttagg
actggatccagattccgcaccttctgcgactttggctttgtcatcctggaaatttcccca
gtatatccagaagactctggcgaatactcttgcagagccacaaatgaatatggcgaagct
gttacaactgcgtcaatgaaagtatctggaaaacgcagcattattttggagtcgcaactg
ccaaagggaatggaaggcactattgataaaatagccgaacttgaaggtttgggtttggca
ccctcccaagcaacacctgaagatgacactggaaaaccaccagagtttattactacacca
tctgatttgatcttgggtgagaactcgttggctcactttgaatgcaggttgactccaatc
aacgatccaagcatgagagtcgaatggttccataacggcaaagcattatgggccggttcc
agaattaagactattaacgacttcggttttgttattttggaagtagctggaatatatcag
cgggactctggactgtacacatgcaaggccaccaacaagcacggagaagcaactgtaagc
tgcactttgcaagtcaagggtagacaaggaattattcttgagcctcagctgccttccaac
ttccgttcaggcacccaaagtatccaaaaattggaagaagaactgtacaaaaaggaagaa
attttggcggaagaagaacagcctaacccaccaagattcatcgtggagatcaaggataac
attgatgtccctgaaggcagtcctgtacatttcgactgcagagtagagccaaagaatgac
tcttcaatgagaattgaatggttcttcaatggcaagccttttgccactggctcacgtgta
caccaaataaatgacttcggttttatttctctggacatcgattacacctatacaagagat
gctggagaatatatttgcaaagccacaaacaaatggggctacgccattactaaggccaga
gtgacttcaaaatcgaagagaacaattgattttgaaagccagctgccagcaggcatgact
gcagataaattgaaagaactcgaaaaaggtccagtttccgttgcaccccaagcagataaa
gtgtacggcccaccaaaattcatcactcatattcaatctgttactgttgaagaatccgaa
tcagtacgctttgagtgtcgggtggagcctaaagacgatcccaagttgagagttgagtgg
tacagaaatggaaagcttttacctgctggacatcgctatcgtacagtatacgatttaggt
tttgtttctctcgatattctcgatgtctattcagaggattctggcgaatatgtatgccga
gcggttaacgatcacggagaagactttaccaaagcacatatcacatgcaagaaactaccg
aacattattctgcagaaccaagttccaaagggcatgaagaaatcagaggccttaatgcag
atggaggctgcaatcaagaaatacacctccgaagtatatctgactgaagatgacctattc
gacgttgaaaagaaacagcctccgcgttttgttactcaaatcttagaacaaactgatctg
gtagagcggcagaccaccaaatttgaatgtcaattggcacctgttggcgatcccaacatg
aaagtggaatggttcctcaacgggaaacctttaccccataaaaataggttcactcctatc
tacgactttgggtatgtggctatgaacttcggctgggtatacccggaagatagcggcgag
tacctatgtagggctaccaatttgtacggcatggatgaaacgagggcggtaattcaagta
gctggaaagccaggaattatctacgaatcgcagcttcccaaaggaatgaagagtattgaa
aagatcagagaaatggaagcttcttggctggttactcctgaaatcgctgaagaagaagcg
aaaccgagatcggctccagtatttatcagcaaacctgagccagttatagtggaggaaggc
gaatgggcgagattctgctgtagagttactggacatccaaaaccaagggtaatgtggctt
atcaacggacacactgtagtaaacggatcccgttacaaattaacatatgatggtatgtac
catatggacatcccaaaaacccggcagtacgacactggaaagatcgaagttattgcccga
agttctgtgggcgaagccattgcggaaacagaactgaaaatcataccaagacaagacgat
tacagaggcgtgcttaagaactcgcctaggccttggtatgacctagaactatctcaatat
caaaaagagcgtcaagaaactgaattagagaaagtattcgacgaacgcaacagtacgctc
cgagaatctggattgaacgtctcaggagttcatgtccaatcgaaagaatactctgaaccc
gaaactgaatggcaaaagcatatcaagtcgaagaagggagaagagtattacacaaaaatt
caacaactcgaaaatgaacaagttagcaaagaagtgcgacttcgtgaagcctcccatcaa
attaccattcccggggagaaaattgtaagcagttccttggccagaggaatggcccaacaa
tatcaagacaacttggaacaagtacctgaaaggccccaacttcagtcaattcccagacta
cccaaggcagaaccagcaaagatcacgccacacaaagaccaagtttccctcaggaaaacc
gataaatccaaagaagaaatgcaaatcgaatacgaaatcgactccaagtcaggagcgtat
cctccagggcccacagaatctggagtacatggacgagaagtttacgttactaagcaaaag
caaactcaaaaagaacgtcaaggagatttggagattactcgcaacatcacagccactgaa
accactgatgtggagcacaaggctaaaactcaagagctgctggtgcaaggacaagtgcta
ccaaccaacccaccgctgtttaccaagaaaatacaaccctgcagggcatttgaaaatgat
tctgctagattcgaagttgaattcgacggagatccgctacctaaagtaacttggttccga
gaagacttccctattacaagctcgccagacttgaagatttacactttcagcactaagtcc
attttggtgctgagacaagtctttatggaagactctggagtgttcagcgttattgctgag
aaccgcggagggactgccaaatgcagtgccaacttagtggttcaagaaagacggcgacaa
ggcagaggcggaataattccaccaaatttcgccaccaccatccaatcaacatcggctagt
gccggtcagcttgtacgctttgatgccagaatcaacggcactaaacccatagatgtttac
tggctgaagaatggaaagaagatcacttccgatatcagatacaagactttggaagaagac
gacttgtacactttattgataattgaactggttcccgaagacactgccaaatatgaatgc
gttgcaatgaaccaatcagacgaagcgcgctgcgaagctgaccttgcagtactatcgcct
actgccccacaaaagccttcaaagcccaccactcctggaacagaaaaacctccaaccatc
gtggaaccacttaaagaccagaacatccgcgaaggccaagcagtggctttcaagtgcaaa
atcaccggcaaacctacaccatctgcaaaatggctcaaagccgacaaagtgatcaaacca
tccagatatttccagatgagcaaagagggtgactactgtacattgagaatctccgaagca
tttcctgaggacgaaggagtctacaagtgcgtagccgaaaatccggctggaacagttaca
gctcaagcaaaattacgagttcttgcacctgaaactcaagagctagctcctagtttaaca
ccaatgaaagacgtgatcgtgcctgagggtagtccagctcaatttaagacttccatcgct
gggaaacctaaacctaccatccaatggctgagagagggcttccttataccagaatcacca
gacttccagatgatccaagaaggtagcaatgccatccttctcatctcgaccacctatgaa
gaagattctggggtattcgcatgccgagccacctcatcagcaggctccgtagaacagtcc
gccaaacttatcgtcaaaagacgtcctggaacgttccgtaaatcgccttccaccgccgtt
tcttcccaaccgggaaccaccccaatcgccacacaacttaacggtgcaccaactcccggt
ggagttggtgttagctcagtaccctttgcacccggctcaaaaacgggccaacccttagaa
cccaatgaacttccagtaggggacgagtccctattgtggagacggtttgcgcgaaaacag
ctcgaaaccagtgaagagtttaaagatttatctaaacccaagcaagtccaaccgtggact
gaagagcaaatcgtgttaaagaaagccaaagtggaacatagggaaccagtgaaggagaaa
cttgaagaagttcacctgaaagtaagcaaaccagtgcaaaaagaaataccgagagcagtg
ttggaagatgtggagctaaagccagtcagcttagaaaaacatattactgattcattcgta
gcgcagagcattgaacaagctcaagtcgcacagcaagattggcgcaccgctccaaagact
ccaagtagtcagattaggtcagctactgaagacagtactcttctaacattggatcaaaaa
caacaagaacacatagtgaaaactactccagagccagcacagaaagactggcggacaccc
aaacctgcagatatagcagctgaacttaagcgccaagcatggcgtcaaactttggagaaa
caagattcagtcgaaatagacattgatactgtcctagctaaagctcaacatgcggttcgg
aaaattcccacgcctcagcctcaacaggcaaaaataattccttggacggaagaaaagata
actctcaaggcggcccctaaagatcaaatagctaaattcaaagaaattcccaaagaaaaa
cttgaagatgttgtattaaaacctgttactttggaagaaatccaagcattaaaacaagcc
aaattagaaaaacctagagaaccgggcgaacctgttccatggattgaagaggatatcgac
ttgaaaccaacgccgcaagagaagaaggaaatccccaaagaaaccttagaggaggtgcat
cttaaatcagtagaccttacggaattgctggataccaaacttacccctctgagactggaa
ggagaaggaataccctggacggaggaagaaattagtcttaaacccaccttgcccgaaaag
aaagaaattcccagagaaactcttgaagaagttgccctcaaaccaattaccaagataccc
gatatcagagatactgaattgaaaccgctaattacggaaagaaagcccggtgaaccgatc
ccatggacggaagaagaaattcgcctcaaacacgccgttattgagaaaaaagaaatcacc
aaagagcaactggaagacttctcacttaaaccactagcgcaaattcctggtcagaaacca
gcagaacttctacctgtgcagcaagaaatacaagaagaaacgttggaaattcaattagaa
caacaagaaatttcaaaacaaaaatctgctgcaaaaactgaaattcgccatgttgaagat
cgaacgctgctagacattacaaagcatacctctgaacttatggaatcccaaccagaagta
aaaacctgggaaagaggatcaaaaccagaagcaataacctctaaacaaaccacagaaaca
actcagaaaacaattattgagtctcaacaagtacaggacacagatactaaagcctggaaa
cgagaaacagttgtccaaaaagaagagcatcaacatgcgcctaaagaagcaccagctcct
tggaatgagcaaccaataactttaaagaaaacaacgattgaaagaaagcaaactgcaaac
gaaaccatagaacaagtagacctgaaaccatccaggccaattaaaacaggtgacacagtt
gttcaaactacagaacaaacacaaattgctcaattcgataccgttgaaagaacggcagtt
ttatctgccacggaagacacaaccctactacaggtaacggagcatgaaaaggtttcccag
tcgctaacgttggaagaaaaaagttggaaaagggctcctaaaaccgaaaaaccaactgta
gatgccactacagttcaacatattgaagatgcgagtagacttatctttcaagagcgagtg
gaagaacatggggagacggtggaatcgaaaacgtggcaaagaggaacgaaggctgttggg
aagctggaagaacaaatagctcctgtgcagcacactgaggacactactttggtaagctta
caagaaaaagaagtggtgaaagaagaaatcgttgaagcaaaaccatggaaaaggggcccc
aaaacaacagaattactaccaaaagaacagcaagaaaaacctttaatccctgaagaaatt
aagccgaaggcagcccccaagaaaacacctttagcgagggaagacgagcccattccttgg
aacaagcaagaaattagtttgaaacctactccaaagaaatccgtagaagaaacaactaaa
attgaggaagtttccctgactcctattaaaaaaccagtacgttcagtcgatgataaacaa
attatcacatctgacgtacaagaagaaacaacagcagcagtccaagaaataccaagcgaa
caaaatgaaaaacttagttcgattcatcatgttgaagataaaaccgttattgagatgaaa
gaacaagttgaatctagaaaagatacaaagcttgaagagaaaacttggaaacggggccct
aagcctgaagaaactccattagaagctacaccagaagaagcatttgttgccgaaaaacct
aaacctaaacagggccccaaatctacacctataacgcaacaagaagagcccattccctgg
aacaaacaggaaattagccttaaaccgaccccgaagaagaagatagaggatgcaccaaaa
caggaagaaattttgttaacccctgtaaagaaaccagttagaagcactgaagacaaaaca
acaaccacgtctgatgttacgattgaagagcgatcaaaaatagagttaaagcaaccggat
ttaaaacctggcaaacctcaagaagaccttagttcaattcatcaagttgaagataaaatg
tttattgacatgaaagaacaagttgactctaaaacagatacaaaacttgaagtgaaaagt
tggacaaggggtccgaaacctgaacaagctccactagaagctaaaccagaagaagcgtta
gttcacgaagaacctaaacctacgcaattgccgcaacaggacaaaatattggaagcaaaa
ccatggaagcggggtccaaagccaacagacataaaaccaaaagaacaacaagaagaactt
gtaattccagaagaaattaagcccaaggcagctttagacaaaatacctttagcgaaaaaa
gaagaacccattccctggaacaaacaagaaattagcctgaaaccgacacccaagaaaaaa
atagaggaagcgccaaaacaggaggaaagttcactaactcctgtaaagaaaccagtcaga
aacatcgaagacaagacattaattacgtctgatgtcacggttgaagagaaaccggatact
ggtacacagaaacgcgttacgaaaccagtgcacaaacctcaagaggaagaagtttcaact
ttcataacgcccgcaagtgtagtggaagaacaacttgaacccaaagcgtggaggcgaggc
aaaaaacctgttggcaagcaacccgaagaaagtgtggaagaaacaattactgaacttcct
gaagaaattcgtgaaacaaagaccgtcactgatggacttgaaaagaaaacaattgaacgt
acacgggttattaagaagaagaaaggaaatattgaggaaactactcagattgttacggtt
caagaagaaggcaaaacaccacaaacaactgtaaccgtcgtcgaatcgatagcaccagaa
gaaacgcaaccattttatgttgtggaagaactgcccaccaaggtccaagaaaccactgtt
attgaacaaggcatacctaaaaagataatcgaaaggaaacgagttattgaaacaaagaag
ggcgacagaaaggacgtaacagaaataattgtcacacagaaaccaggtgataagccaata
acttcagttaccgtgaaaaacgttccagttgtcaaacaagaaccaattgaacctgaatac
gtagtacaagaactgccagttcaaattcttgaaactgtggttactgatgctagtaaaaca
accaagaaggtggttaaaacaagaacgattcagaaacaaaaagacggtataaaggaaaca
acacaaattgtgactgctgtggaagacggtaagaaaccggagcacgtagttaccactgaa
cagcatccggcaattgaagaagaatcaatatttactgttcgtgaattacctcttgaaata
ctcgaatctacagtgattgaaagtggaattccgaaacataggacaaccaaaaagagagtc
attgaaaaggtgattgctggaaagaaagaaattactgaaattatcacatctgaacaagac
gataagccaaccgagacaactgtaacggtaacggagcaagacatcaagaaaagaccaaag
aaacagcgactagaacaaccgaaagaggaggtgattccctggactgaacaagttcagctt
aagcgtgcaaaagcgaagaaacctcaggaaagtgaagaagaagataaggttcagttaaaa
caaatacctacgcagccatccgcccaagcaataatagaagaactgcccgaacagattcag
gtgtccactacagttgataaaggtaaaattgagaaaaccgtaacgaaaacaagagttata
aaaaaaagaaaaggtagtaaggaagaaacgactcaaattgttactgtcgaaaaggaaggc
aacatcccagagacaacaattgtaactgaaaaacaatcaataacggaggaacaaaccact
cagccgatatatttggttaaagagctgccagaagaagttttcgaaactactgttattgaa
gaaggagttccgaaaaagataactgaaagaaaacgagttattaaaaccaggaaggacaac
aaacaggaaataactcaaattacaaccgtagaacgggaagacagacccacggaaactgta
gtaacaattacagagagcgaagccactgatttcgaagaaatgccaattgagcaagaattc
gcagtcgaagagcttccaacagaaatctacgaaaccacaattattgagaaaggcaagcca
aagacagttgttgaaaagaagcgaagaattaagaagatgcaagacgacaaagtgcaaact
acagaaataattacagtagaagaaccaggcaaaaagcctaaaacaacagttcggacgttt
gaagacaccacccaaacaattcaagacctagaaaaaccgctaatagaagaattacctgaa
gacgtgcaggaagtaacagtaatagatgcaggagtaacaaaaaagaaactgctcacaaag
aaaacgctaaaaaagacaaaaggcgataaggaagaaactactgagattgttactttggaa
gaagaaggtcagaaaccagagacagtagtcacagtcaccgaggaaataattgacaagaaa
aagccccaaaaaatacctgttccacaagaaacagtagaaattccctggacaaaacaagtt
gaacttaaacggactccaaagacaaacaaacccgaggaagaaacacgtgaagaaattcgg
ttaaaaccagtcaaaaaatcgcaaataccccagcctgaggaagctccagtagttcaagaa
cttcctgaagaaattcagcaaacgaccgtcattgacaagggagaagccaaagtgcaagta
actaaaacgcgtgttattaagaaaagaactggggataaggaggaaaccacgcagattgtt
acagtagaagaagacggaaaagaacctcaaacgactgtaacagttgaggagcaagaagtt
cctaaggcagtcgcaacacaaccaatctataaagtagaagaacttccggagaaaatttct
gaaagcactgtagtagtacaaggtattgaacgaaggaaagtagaaaaaaggagagtaatc
aaaacaacaaaaggcaaaacgcaagaactcacagaagtactgaccacacagttagagggc
gaaaaaccagaagtcaccattacagttcatgaaattgaagatacgcttcctgaaacacta
gacgagacattcgaaactgtagaagaactgccagttcagatctccgaaacagtagttgtc
gataaaggtattcgcaaaaagaaggtcgcaaaaacgcgaacaatcagaaaggaaaaagat
ggaaagcaacaaatcacagaaattgtcactattgaagaagaaggcaaaaaaccggatatt
caagttacggtccatgaagaagacaaacccgttgaaaaaacggtagaaaaaccggttaca
gatttaccgtggactgaacaagtcaaactcaaacgaactcctaaaaaacaacaagaagcc
cccgttgaaagtgaaataataaagcttaaaccagtaaaaccggaaatcaccgatacacct
gtgactattgaagaacttccggaagaaattcatgaaacggtcgtgactgataagggaaaa
atcagaaaacagacatccaaaaaacgggtcattaagaagaacgtgacaattcccgaaaag
gaggttgttcaaccgatctataaagtggaggaagaacccgagcagatacttgaaacatct
gtaatagaggacggagttagaaagaaacaagttcaaaagaaacgtgttattaaaacaact
aaaggcgataaacaagaagttactgaaatcgtcgttttagagcaagaaggtaaaaagcct
gaggtaacagtaagaacagaagaaattggcgcgcctaaaattccatctgaacaacctgaa
gacacatcaattgaagaactgcctattgaaattagagaagaagtcgtttttgatcatgga
gtttccaagaagaaagttgaaaagaaacgaactatcaagaaaaaacgagctggcaaagat
gaaattacggaaataataaccgtagaagaagaaggcaaattgcctgaaaccagtattgtt
acgtacgaacaggttccagaggaagattcagaaaaaccttttattgaagagttaccagaa
gaaactcaacaggtagtggttgtagatgaaggagtcactaaacagaaaacgattagaaaa
cgcattattagaaagagcaaaggtgataaagatgagattactgaaatagtaacactagag
gaagaaggaaaattagctgaaacaactgtaagcattactgaagacgatcgcaagccagac
caaataaaaccgaagcgaaagcccaaaaaagtggaagtttcagaaatcttacctgtagtt
gaggtagaagaattgcctgaagaagttcaagaaacaattgttatcgataaaggggtcgcc
aaaaagcaaattaaaaagaagcgtgttattaagaagcgcagaggcagcaaagaagagacg
actgaaattgtgactgtcgaagaagaaggaaaagctccacaaatccaagtccaagttgaa
gaggtgcaaattccggaggaaatggctgaacaacctatttacacagtagaggaactgcca
gagcaagtatctgtcagtacagtgattgaaggaggcttgaaaaaacaaaaagttcagaag
aaacgtatcatcaagacacgaaagggcaataaacaagaaattactgagctgaccactaca
gaaatggaaggcaaagcaccgagcaccacagtaacaattactgaagtagaagcaccagct
gatgaagttccggttcagaccgagtatgtagtcgaagaattgccaattgaaacccaagag
gttatcagtgttgatggaggagttaccagcaaaacggtaataaaaaaacgcactttgaaa
aaaaggaaagacggcaaagaacaaattaccgaaatcgtaactgtgcaagaagacggcaaa
aaaccagaaacaacggttacaatatcggaagactttatccatccagacactattttccta
caacctcttgttgaggagctaccagaacaaatatcagaaatcatagttgataaaaagggt
attaaagagaaacaggttatcaagaaacgtgtcattaaaaagcgaaagggtagtaaagat
gaggtaaccgaaattattacgcttgaacaggaaggtaaaaaacctgaaagaactgtgact
gtaacggaagaagaaacaccacgaaaaccgaaaaagcgagtcattgaacaaaagaaagcg
gaccttccttggacggaacaagtcaagcttaagagagcacctaagcaaataaagcctgca
aaagaaaaaggagagactgtcgaacttaaacccgtcaaaacggaagaagtaatccaagaa
ttgcctgaggagatccaagaaacaacagtttttgatcaaggtgtaatggagaagaaggtt
actaagaagcgcgtaatcaagaagcgaaaaggaagcaaagatgaaactctggaaatttta
acggtacaagaagaaggcaagcaaccagaaacaacagttacaatcatcgacgaaactccg
aaagttcctgacgtcaccttaaagcgagcgaaaaaagaaaaagtaaaactggcgaaggga
actgacgagaaaattgaaaagcttcatcccgccaaaatggttcaaccagattcgcttctt
accacaatggaagaattacctacagaagttcgcgaaaccacagtaattgaagatggaatt
actaggaaacagaaaacaagaaaacgcgttattaaaaaacgccgaggtagtaaagaagaa
acaactgagatagttaccgttgaagaagagggtaaggtaccccaaacaacggtaactatc
gaagaagacgtggctccgaaaattgcggaagagcagccattgtatagagttgaggaactc
ccagaggaagtgtatgaaacaactgttgtagagcaaggtcgaccgcagaagaaaattgtt
aagaagagggtgattaaaactaaaaaaggtgacaaacaagaaattactgaaattgttatt
acacagaagggtagagaggcacccgtgaccgaagtgataattcatgaagaatctattcca
tttgaagagatagaacaaccagaatatgcagtggaagaattacctgtggaaatccaagaa
accgttgtggttaaagatggaatttctaagaaaagggtcgaaaagaagcgaacaattaag
aaaaaagataaacagggaaaagatgagataaccgaaattgttacaatccatgaggagggt
aaaaagccccaaacaacggtaacagttcaaacacaagacacggtgtcagatattccggat
aggccagttatcacagaacttccagaagaaattagtgaagtcaatgttgtagagcaaggc
gtcatcaaacagaaaattaagacaaagcgaacaataaaaaagaggcgaggtagtaaagac
gaaactactgaaattgtggttatagaagaagaaggtaaagccccgctaacaacagtgctg
gtgacagaagagcctgtagaggatcaacagttaattccaaaaccaaaaataaagaaaact
aaaaagcaagcaaaaagtgagagtccactggtcacacctgagggctacctttttgtccca
agtctggcacatccaaaagaaacacaacccgacgatgttgtcgatatgttacaggcggaa
cttatcaaaatgcgccttgccaaaaatctaccagaacacgtagtgcctgaagatgtacct
aaatacacagtcacggaattacctgaggaagtccaagaaacgaccttcattcaagatgga
gtttccaaaaaagttagatcgcgaaaacgggttattaaaaaacgtattggtgacaaagag
gaaacaacggaaatagtttccgtagaggaagaaggcaaagtgcctcaaactactgttact
gtagaagaagaaacaattccagaagatataccggaacaaccgatctactctgttgaagaa
ctccctgaagaaatttctgaaaccacagtcctagttgaaggaagacctaaaaaaaggatt
gaaaagaaaaagactattaaaactcgaaagggtagtaaacaagaaataaccgaaataacc
gtgactgagcaagaaggcaagaggccagtgactgaagttagtattaaggaaattgatatt
cctgaatctgaaatccatgaagggcctcagccagaatatcttgtggaagaactcccaatt
gaaattaaagaaactgtagtagttgaaaacggggtatcaaagaagacagttcaaaagaag
cggactattaaaaaacgcaaaggtgataaagaagaaattacagaaatcgttactagtgaa
caagaggatgaagcgcccagaaccattgtgtccattgaggaaaagccgattactttccaa
ttagaggaggtaccaaaaattgtggaagaattgccaacagtgattcaagaagtcaggata
atcgaagatggtgtacctcagaaaaggaccattaagaaacgcgtcattaaaaagcgacgt
ggcagtaaagaagaaaaaactgaaattgtgacagttgaacaagaaggtaaacttcccaaa
acgaccgtcactgttgatgaaataacagtcatcgaagagaagaagcccaaagtgaagaag
ccaagaacagaaaaggtcgaagaagtaccatggacggaacaggttcaactgaaaccatcc
aaacggaggccaaaggctgtagaaaaaacacagttggaagaagttgacctaaagccattt
gaagtaccagagaaagaagaagaagtatttagagtggaggaacttcctgtggaaataaaa
gaaaccacagtaatagaccaaaaaggtgtatctaaaaagaaaatagttaaaaagcgagtt
attagcaaacaaaaaggcgacaaacacgaacgaactgaaattgttaccgttgaggaagaa
ggcaaagctccagagaccactgtaatcacggaagaaatagatgctccaaagactggcggt
cctttgtacatcgttgaagaattgccagtggatgtccaagagtctaccttcactgagcgc
ggtgtttccaagaagaaaattacgaaaacccgtaaaattgttaaaaaagaaggcgacaaa
cgagaaaccactaaaattgtaacagtagagaaggaaggtgaaaaaccaaccactgtggtt
acagttgaagaagatgtggctccagaagaagctagcgcggaatcccccagttataaagtg
gttgaaatgcccgttgaaatacaggagactataaccatggagggaggaaaaccaaggaaa
actgttgttaagaagcgaaaaatacagaaacagaagggagataaacaggaaactaccgaa
atagttactgtcgagcgagagggcaaacagcccgaaactaccgtaactgtattagaggaa
attgtagaccaactcccggcagaagtagtagttgaggaaattccagaagaagtagaacaa
actactattattgaaggaggaaaatctaaaatcagaaccgtgaaaaggagaaaaattaaa
actcgcagaggtgaccaacaagaaatcactgatattgtaactgtagaagaagacggtaaa
aaaccacttacaacagtggaaattacagaagaaccagttccagtggatgaaaaaccttct
gaaagcaaacctaaacaaactgtgaagaaaactaaaaaagtaacggaaacttctttgtta
acaaaggatggttacttggtggtgcctagcttagagcaacaagaagaaacgcaacccgaa
ggtgttttagatcttttagagatgcaacttatcaaaatgagactgcaaagagatatgcct
gagcacattgcaccagaagaagtgcctgtgtttgaaataaaagaacttccggaggagatt
catgaatccatagaactgaaagatggcattcgaaagaaagttatcactaaaaagagggtt
attaagaaaaggagaggtgataaggaggaaaccacaaacattgtttccaccgaagaagaa
ggtaaagctccagaaacaacggtaactattgaggaacagcagctaccggaacaagaaact
gtgcaaccaatatacacagttgaagaacttccagaggaagtttctgaatctaccgtgcta
attcatggaaaagcgataaaaacagttaaaaagaagagagttatcaaaactcgtaaaggt
ggtaaacaagaaacaaccgaaatagttaccatagaacaggaaggtcaacagccaatcact
actgtggaaattcaagaaatagaagcacctgaaattgaagaagtacctgaatcggaatac
agagtcgaagagctgcccattcaaattcaagaaagtctagtaattgaggatggagtcact
aaaaaaagagttcagaaaaaacgaacgattaaaaagcggaaaggagataaagacgaaaca
actgaaattgttactattgaagaggagggaaagcaaccagaaactttcgttactattgaa
gaaaggccaactagtggagatgttgaggatattcctgaaattctggaagaactaccaacc
attactgagcaggtaaatgtagtggaagacggaatacttgtacaacgaaatgttaaaagg
agaatcataaagaagaggcgaggaagtaaagaagaaaaaacggaaattgttacagtagaa
gaagaaggcaaaacacccgaaaccacagtgacaatagaagaaaagccaaaaaagaaaaca
gcaaagcgcgtaaaagctgaaaaaattccgtggaaccagcaggttcaattgaaacctact
acaaggaaatccaaagacatcgagaagcctgagatcgaagaagtagagctacagccattc
gaattacccgataaagaggaaacagttttcaaagtggaagaacttccagtagaaattaga
gaatctacagttatcgaccaaaagggtattgcgcggaaaaaagtagttaaaaagagagtt
atcaagaagcaaaagggagataaacaagaaaggacggaaattattactgtcgaagaagaa
ggaaaagcccctgaaacatctgttactatagaacaaattgaggctccagaatccgacagt
cctctttatgttgttcaagagctaccagaagaagttcaagaaagtactgttgtagatcat
ggcgtgtctaaaaagaaaatcacaaaaactcgcaaaattgtgaaaaaagaagggggtaaa
aaggaggttaccaaaattgtcaccgtagagaaggaaggagaaataccagaaactgtcgta
accatagaagagggacaaactacacaagaggcgccagaagaacagccagaatatatagta
gaagaattgccaattgaaattcaggaaactaccgtactatcgcacggtaaacccacgaaa
accatcgttaaaaggcgaaaaattaaaaagcaaataggagatcagcaagaaacaacagaa
atcgttaccgtggaacgacctggtgaaaagccagaaaccacagtcacggtctcaaaggaa
ttggttgaagagttgccagaaaaatcagtaactgaagaacttccagaagaagtggagcaa
actacgattattcaaaacggcaaatcaaaagtaaaaacagttagaagaagaaaaattcag
tcgcgtaaaggagaccaacaagaaacaactaatattataacagttgaagttgaaggaagc
caaccagtaactactgtggacactacagaggaattcattccagaacaacacgaaaagctg
aaacgtaaaccaaagaagaccagaacggaaaaagtaactgaaacggcgttagtgtcgaag
gaaggttatcttattgttccaagtttagaagagcaagaagaggtaacacctgaagaagtt
ttagacttgttggaaatggaattgattaaaatgcgactagaaagggatatgcctgaccat
gtggtagctgaagatgcacccaagtatattgtcaaagaactgccagaggaaatcgaagaa
acgactgtatttgaaaatggggttccaaagaaagtagtaacaaaaaccagagtaataaaa
acacgaaaaggtgacaaagaagagactacgcacatagtgtcagtagaagaagaaggcaag
cttccccaaacaactgtaaccgttgaagaggaaacggtaacgacaaaagtaacagagcaa
ccaatttatacagtagaagaacttccagaacaagtttctgaaaccacagaaattattaac
ggtaaaccaacaaagacagtggagaaaagaagagttattaaaactcgaaaaggtaaaaag
caggaaataacagaaattgtcactagagaacaggaaggacagcagccgacaaccactgtt
gaaatcgaagaaattgaagcaccattaattaaagaagaagaaccgcattacgaagttcaa
gagctgccggttgaaatacaacaaacagtagtaatagaagatggtgtggcaaagaagaaa
gtgcaaaagaagcgaacgattaaaactcgcaaaggtgacaaagaacaaacgaccgaaatt
ttaactcttgaagaagaaggtaagaagccagaaactatcattaccacagaagaaaaacca
attgccgaagctgaagatcaattatcggagagcatagaagaactgcctacaactgttcaa
caaatgagtataattgaagacggaatacgaaagactcgcagaattaagaagcgggtaatt
aaaaagcgccgtggtagcaaagaagaacaaaccgaaattatcaccgttgagcaagagggc
aaatcacctcaaagtacagtaacagtggaagaaattctagtaccggaagaagataagcct
aagaagaaaaagccaaaacacaaaaaggctgaagaaattccatggactgaacaagtgcaa
ttaaaaccgactaaaaaaccaaagaaacctacagagaaacaacaaatggaagaagtggag
ctcaagccatttgaggttcccgataaggaagagcccacgttcaaagttgaagagcttccc
cttgaaattaaggaaactactgttatcgaccaaaagggcgactccaagaaaaaagttgtt
aaaaaacgagtcataaagaaacaaaagggcgacaaacaggaacgaactgaaataattaca
acagaagaagaaggtaagccaagtgagactacagttaccatagaagaactagatttcctt
gaagacaagtccccaatatatgcaatagaagaactgccagaacaagttctagaaacagtt
ataattgagaagggtatacctaaaaagaacgtcacgaagactcgtaaaatcgtgaagaaa
gaaggtggcaaaagagaaacaactaaaatagtcactaccgaaaaggaaggcgagcaaccg
gaaacaattgtaacagtcgaggaagatgtagctcccttggaaagtgaaacagcagaacca
atatacgccatagaagaactgcccattgaaattcaagaaacaatagttattgataagggc
attccaaagaaaacagttattaagaagcgcaaaattaaaaagcagaaaggggatcaagag
gaactaactgaaattgtaacagtagaaagagaaggtgaaaaaccagagactactgtgact
gtggtggaagaagacgttcttgatcagtttccattgaagccatcggttcaagaacttcca
gaagaagtcgaacaaactgtaatcatggatcagggcaagcctagaaagaaaaccattaag
aaaagaaaaattaagaagaaggaaggggataaagaagaaaccaccgaaatcgtcacagtg
gaagaagaaggaaaaactccggaagtcactgtctcagtagttgtggaaacaataactgaa
gttgaagacaccattgttctgaaagttgacgatgataaacccaagaaaattaaaccgaag
aaacatactatagaacaacagcaaatgaagccggaagaaataaaattgaagcctacccaa
ctgccacaaaaaccggaaaaggccgaagttgaagaatttgcattgccggagctagttaaa
ctgaaacctgttgttaagaccgagcaaccagacaaaagcgaagacttggaaaaggttata
ttaaaaccagtggagcagcccgacttaatggaagcaagcataattgaaaagaaagtgaag
ccaacgaagaagaagaagcacgacgttgaactgccagaaattccggatgctgagaaatat
attcctgaagttgctgaaaaatatgagtttgaagaaagtcctaaagagcaggaagatatt
cctgctactccttggaggcgacagccaaaaccaaaggtagaagcagaggccgttgaaatg
ccaggcttaaaactaggcaaaggaaaagttcccaaagaagagaacgttcaggaagtagta
aagctaaagccggttaagcgggataaaaaaggagacgttgaaattcccgaaaaatcgaaa
cctattaatgttgaaaaatccgaattcgaaccaaaagaattcgagaagattccgatcact
gcacctaaacgggaaactgaagacactcctaaagaagacgaaataactgtcattgagctg
aaacctacggaagtcaccgaagaagagcacgctcctgatgaaacaacaccatggagaagg
acacctaaaaagaagaaggacgaagttcccgaggtaaaggaatggcctcggggtaaaaga
aaacctttacccgcggaagaggtggaagatattagtcttaaaccaatcgataaagttata
cctgaagaaccagtgcataaagttatcaccgaagacgtaaaatctgagcttgcatacgaa
gtgcctgaaggggactttactgataaactgggtctgaaaccggaggacagaaaagaaatt
ccagaagaagaggtaacaacaataacaaagaagagaaaaattaaacaaaaagataagccg
aaaccggagaagccggaagaggttgttttaaaaccaatccccaaagaagaaattccggta
gaattaatttctaccaaactggatgatgttgaagaaactcctttagttcccgaagtatca
gaaactgaaataactcttatggataaagagaaaaaaccaaaagaaatatcagtccccgaa
aagccatctatcaaagagaaagaagatgaagagtttaaaagagacattgatgtccaaata
gtgtccaagaaggtcaaaattgagaagaaaaagcgcactgtaaagttcgacgacagccaa
cctcttcccgagcttgaaatcatttctcagaaacgtactactgaagtgaccgataaagtt
ccagatgaacaactcacggaacacactggtttgcatgaggaaactacaattcaaacatcc
ctcgtccaaaaaacacttggcaaacgcgttaaaacaaaaaccgtcgctccacgatttatc
aaaagggttgagcctgtggtggccgaagaaagccatcctactcgcttggtgtgcaaagtg
gagggtactcctttcccagaaataacctggtataagaacgaagctgtcttccggggcaat
gagcgcgtttttatcacagtcgtagagaataccgtcactttggagtttaccaaagtggaa
ccacaagatgtagccgtttattcgtgcaaagctaccaatccggcaggagttgctacttct
accgctaatctggttatcttagaaaaagaagaatcaggaattgctcctcgatttaccaaa
ccgctcaagccaaaaattgttgaagaaacagcacaggcaattttggaagctactgtcatc
ggtcaaccaactccaattgtgaagtggttcaaggaagatgaagaaatcacgccgcaaccc
ggaaggcaaattacctatgataccaagactggaataacaactttggaaattctggagccg
tcacccgatgacgaaaaaatctataaagtaatggctcaaaacaaattcggaactgccgtc
tgcagagccaacctcatcgtttcgaaggctgtagaagttcaacagcctgtaataatgcaa
gccccaaagattacaaagcccattaaagctgttgtggccaaaccgtcagatgaagtggtg
cttgaagctgatgttgaaggtattcccaaacctgaaattgcgtggtaccggaatggcaaa
gaaattaaacccgatgacaaatatgatattacggtaacagaaaacacgaccacactggtg
atcaataaaaaagtgccgaagaaactaaaagctggcaaatatgaagtgcgtgccactaat
ccgagaggagaagcaaaatcggcaagcaccgtagtgatcaccgaagaaaccagcgaagcc
aaagcaccaagatggatcaaggccatcaaacctcaaatagtagaagaaggagaggtcgta
attctggaatccattgttgaagccattccgacagccacattccaatggtacatacgggac
actcccgttacctctagtccagatgttcgtattgtaaccaaagacaataaatcaacactt
ctcatcagcgaaatcactccagaatttgccggtccaattacatgcagagctgaaaatgtg
gctggatccataactcacacagcctcggtcaatattgttaaggaaactccttggcaggag
actgaagagctggtatatccaagattcgtcaaacccatatctccaatcagcgttatggac
ggcgaaaaagttaccttcagctgcgtggtaattggaaagccaactccaagagtacaatgg
tattttaatgacacacccattcacgaagcgcaagacgtagtggtgtctcaagataacgaa
ggtgtttgcagcttagctatttcggaagcttttccagaaaatgctggcgaatacacttgc
agagctatcaacaagattggtgaagcagtttgcaaaacatcattagtggtggaagcctac
gaatacgttccagattccgagctcggtcatatgaccggctcggaagaagacttactagaa
gataagacgataagtgaaggcctcattacatcagatgaagaagagtttgcccccagaata
atcaagaaattacctgaagttgtgcaaactcaagatggccaagttacaagattggaggtc
aaagctattggtagacccaaaccagaagggaaatggctgaaagaaggagacgaaatcctg
ccatcgaatgaattcatcattgaaaactttgaggatggaacatccatcttgacactacct
gagacgtatccagatgatgtcggagaaatcgtttacgaggcagaaaacccgctgggtgtc
gcatccacagtgacacacttacttgtggaaactgtcgaaggtattgtcggtacaaaaatg
taccgcaaacccgaatgggtcacccatatggaagaactatcgacagctctaaaagctgtg
cactccgtacctaccttcgtcaaagaaatcacagatatccgaacaacagaggctgagact
attgtatttgaatgcatattcactggaaccccatccccagatatcgtatggtaccacaac
aataaagtgctacgcaacgataatcatgtgaaaatccgaattgaagacaacaagactacg
tgtacgatcactgaaatcactaaagatcatgtgggtacctatgtctgcaaagccattagc
gatattggtgaagcaactacaaaggggcagctgttcgtccaagaaattcctgaacaggct
aagaaggccattctcgtaaagaaagctaaagaggaagaagaacgagtcaagaaagaaaga
gttactatcgagaaaaagcgcgaactgaagaagaaaaagcgcgcgtcgctgctcacagaa
gaagaaatcaaaccactggatgtaacagaaatccaatcaagtgaggtcactgaagaaata
cctttgtcgactacagaagaagccaaagcaaaaccgattttggatattctagaatcagta
aagactgaagcaatagcctcgtgcaggaaaattgacgaaaaagaggaagagtctcccctg
gaaaagggcacagcaaaactttctcccactgaaccactgcgtatcgatgaagtcctggct
gaagaaattattaaagatatcgagaagatcttgccccaggtcgaaagagccagacccaca
actcaagaagggccggaagaaaccgtgaatatcaccgaggtgaaactagaacaaataatt
gagaggtgcgaaaaaataatacgaaaaagtgaagtgaaaatggccagagaagtcactcac
ttgttagagttgatcaacgctaaagaatttggcgtaggccaggcacctcttcgcgaaatt
gccgaaatcgtatatttgctgaggaacggaatcaccgttaaagaggtcacagttctctat
gatgacaacaaatttccatcgctaaaatccccagaagctcaatctgccatggtcaatgtg
gtagaaaggaagggccatggggctctaatatcggaagttttgactgaagaaacaaccatc
gacgaaagccagttagcggctactgtaggattcagagctatgatgaagatggttgaagcc
aactatgtatccgtagaggagatcctcactaatttcaccccagaagattttatgcaaagg
gtatgggaagcaactgaaactgtggaggtcccgaaagaagttccgcttcaaacgaccatt
tcctcacaagtggaagttcacgaggatacgacgacgaaaatcgtaaagagaaaatctaaa
aagaagggagaaaatgaagaatccctcgaaatcagcgaagtccgtgaacgtaccgtgcag
ggtgacaaagcaacattatctaagagacactccgttgaaattaccgagatcatagacaca
cctgagaccggtggaaaaacagacgtagaaatcatagaagagattgacaaagaaaggatc
gtaaaaaaagtattaaaaacgcgacgtcctcattcagaagaataccttatagatgaagag
gatgttgacaaaatcctccctatcgacttccatcctcaaactcaactgccccaaaatata
ccgtcggtggtttccgaagccacacataaagacgaaattacccaaattgatcgggattta
gaaaaagtcaaggcaacagtaggaattctgcccttaaatgctatttcacaagagcaacca
atttctcaagaatctgaacaaccgaaagcagaggttacaacaataacgcaacaagcttat
caaaccggtgaccagttcgaggcctatgaaacttccgaaattaactcgcaaaacattcca
gaacattttgactcaaccatgaaaccgcaggcatataatgcggaccgaaatattacaata
acagagagcctagtgattgaagagatttacgcaggcgatacttctatcaccttggaatcc
aagcaagtatcagaaacaaaagctgagtttagcataattgaacagaaagcgtccaatatt
caagaagttgaagtgcaccaaaaggaagagactttcaaacctctcgaatatgatcagaaa
tatccttttgaaactcacattccaaaggacagttcagaagcttcatcaaccagccaagta
actcaaatagatcatactgtggagcaagcaacagccgacatcaatatcttaccacagatg
gttccgatacaggaaaaatgcgaggctgacgaaaaagaaggagatcataaacagtctgcc
actgttttatctcaggcgtcaagaaccatcgactcagtagaagcgttcgaaacaaccgag
caaaacgtccagaatcaagtgggagaatacgacaaaacattcaagccctcattttctaat
gcccaaccggcttttagtatttcagagagcataaacatacatgaaataaatcttggtgac
attcccgctacattatcaatcgaaggccaagttgagggtcaagcctttgtttcaatactt
gaacaggaagctaaacatattcagcaggtggatgtttcagataaggaaaaagacttagaa
gcttttgctgctcctaaaggagttgaggctacaaaagcattcattactcaagaaggaatt
tccattgaagaagtgcagcaagcaatgtcggaagataaaatggacattgtcaaacctgta
ggagtcaaaccgaaaatgaacattgatactcaagaaagcctaattgttgaacaagtcctt
actggagataagcctggaaaatatcttcctcaggcatttgtagctaccgaagtggctaca
agatctatcatatcccaaaagtctattacacagtcccatattcaggctccagagcttgaa
ggcgaatatactccaggcaaactgccccccacccaggtagcaaatgagaacatctcattg
acagaaggaatattgatttctcaaactcaaactgaagacagggagaaggtattttcaaaa
tccaacagtcccgaacgggccaacgccctagaagacatccttctacacgaaagtttggta
gtccgaacagtagatagccaagcaccgcaaggagacattacaactgaagaaactgaacaa
tttactgctaccgttgatatcactgaaaagcaaaccgttcaaactgaatcagttgtagct
gcagagtctgaaaatatttatgagcagagccaagtcgacaccaaagtggcgaccagtgat
tttagactacttgaagtaagcgaaaatgcgtttatcaccgcacatgagtcagagaatgac
ttggcaccggatgaacataaaaccaaagtcttggccacctcaagtattggtcctaaggaa
tctttggttgtggaagaagtggagactggagattcacccagtgaatttaccgatcacctg
aaatacaaaactgattcagccgaaaccaatattcaaactacggaagcgcaagttactatt
gagacccaggctggtgagagtgaaatgccatcagaacaaagtcaaccagaagcgtacaat
attgacacaactataaccagaactgtagacgagatttgcataactgaaaatcaaacgatg
gaaagtgaaaagttattagaacagtttgaaacaccagaatctcaaaagggcaaacagaca
agatcacacttacttccaaccggaataagtgaaatagtcgaagtagatgatagcgagagt
aatttgaaaattgacaacttagagcaaggcccagccagtttcaatcagccaacattcaca
gaaactgttatttctgaagctgttgctgatgaaggtttgaatgacatagaaagcgaaaaa
cctgaagaaaaacaagcttcgtctgaggtccttctccagcaagccgtcaatatttccgaa
gtagtggccgatgatcgcgaaaagccatataaatcatctgacgtaaatacgcaagaagct
acagttaacattacgtctagccaagtggccagccaaactatcaccgattcgaatattgca
cctgaagatctaatggtgtcaaaaccggtggaagaaacggcgcaagttgatcaaagtaca
atagaacatgtttacactttgcagcatgaaacagcggaaaaggaatctgaatacataaaa
cagcagcccgatgctaaatcagctttgttcggtttaactgacgggcttagtggtcccaat
gtaatgcaagtaaccataaatgagaaagaagatgaatattctccacatatcactccactt
gaagggctggggcaaccaaatattacagctcacgatgttgcggtgaaaactgaagtggaa
ctggtggttcatgctgatgaaataatcgaagatgaattgcttactggtaaagccaagaaa
tatactaaaccatacaatgaactaattgtaactgaatccaatgcagtggatgttcacaag
gatttaccagctgatattcatccatattccaagcatgccaatgttgacatcttgccaggt
caggctctgtccgttactgaaaccagagctgagcaaaatgaagaaaaactcaccgtttca
gatgtagataagtccaatgctgttgttgggattgaagagcaacaagttgcgactaaagaa
caaataatcgcggataatcaaaccggcgttttcgatcgcatctcaccagagaaacagtta
ggtatcactagacaagatctatcgcaccctctcgttcaaatggaaattgccgcaggagaa
actgaaggatacagtagcgaagatatcaaaccaaactctaaacaggcagacgttttattt
ggtgaagctgaaggtatcaatgttagtgaagtattcgctggagaagcagaatcgaatctg
ccgcaggatgaatctccccaagttgatcggggaaatgtagctatttcatctcacataatt
gctgttaaagaagaagtccaaccacaagattcaacaaatgcattgaaagaagaggaacgg
agaacagaaaatgctaaaacccaatttagtccgctggacaccattattacgaccgagtca
gtagttggagaacaagaatccaatattgagagggaacatcgtgatactcaaactgctact
tctgagttcgaagaagctacccccatttctgtaacatcgataacagcggcaataaaagag
acagaactcataaaagacgaaatcaatttgaatcaagcaaagcagatcttatcaccacag
gaaaatatacaagtcgatgaagtactagtgaacgactcatttacagattttgatcgatcc
tcgccaaccaaatttattgcatcatcagtgcattcgcaaatgcaatcaattactgaaact
gaattaattactggggaaaaggaagcaaacctagaaaaagatgttcagcctttgcagcaa
agcgccgaagttgaatttggggaaattactacggctgagactactgaaaccgtgatttca
gaaaaagaaggcaaacatgatactgaagaagctacaagcttagtcgcccttacctcaatt
gatgcacaaccagttgctgaatctagccaacctgaaagtcaagatcaagtatcatcacta
attgagcaaaagccggcctttgcaaatgctaatccagaaacatcgttgatagaaggttta
acccaaactgagacactagcacaagagagcgaaacctacttcgaaaagcccgttttagat
acgaaatctgctacagtggacttcacatctcagcacgccgtatcaatcagtgaggtaaag
agcaatgaaactgaaaccaatttacaagtagaggacaaaccgaccggaaaccaggctact
gttggactactgggacatgaacttcctgtgagaagcgaactagagattaacgaaaacact
ggtgatttacaatccagtcaacctgagcattcatcagcacaaccagaaatttcagcactg
agtactgccttgcaaactgagacgattacatcggaaactgaaggcaaaagccccgaagca
gaaaaaatcgaccagcgacatgtaacggtgagcatcgatgaagatgtgggagtagtggta
gaaacagtcactgtggcagataaagaaacagatttgctaaccgaacgacccaccactaaa
gaggctgaagttaatctttcagaaagcaacatcattgcctcacaaagtgaagttaacccc
aacgaaggaattctagacctcgaagaactgaaaccagatgaaacaacagcttcaagcagt
ataatattttcaaatacactaacccaaacgcaacagacagcaatcgaggccgaaactgac
ttagccgacttcaaaaagcccctgtcaacggctgctatcattggtgtagaagcagttgaa
ggaatcacaagcgaacaaacgactgtagctgaaaaagagcagcatttggccgaatttcaa
ctgccgagcagtaaaactgctcttcaaaatattgatataccaggaaaagtggcaggatat
gaaactaccgatattcgcgaaaatccaggtttcttccaacagtcgcaattcgagcagtat
caggctcagcctgccgacgaagttttacatagtctaattgtaacgcaaaatatgtctgaa
gaaaaagaaacagactttcaaggtgaatttaaaccagaaacttccacagtagaactctcg
ttagagaaaggcagaattgtggtgaatatctcggaagtaacgaccgaagataaggaagga
tatattgccgatttggagaaaccgaacgaacaatccgctattgccgcaatagatgccgta
caagttccggtaactgccgaaacgatcagcagcgacaacaccggagtttctgagtatcaa
gcaccgcaaagctcttcggcagttttgaggcaagatgaactatgccagctggttcaagaa
agtccgcaacttcatgagcgtgaagacgttttcgaaaagactgtacctttgaacagaaag
caagcatcagttgcgttcgacgaagaacaaactgtcgaaactagtgaggttgtcagtgcc
gaacgtgaaactgcctttgataaaacccctgctccagacacaagtactgctgattcttca
gtttctggacacataactgctcaggtgtcggaagttcagacctccgatcagactagcgag
tatatagtcgaaaaaccaaaagaaactactgccggtgaagatcaacccacttttgattat
ctaagtcaggggcaaaacttggtattagaagattacttagatcaggatacgccggacgtt
gcaaaaaaaacagctgagaccaaaattgatgagattaattacctcgatatatctgaggtg
gtgctgggtgatgcgtatggcaaggcttcgaaggaacccttgcttgtagaaaatgcttat
gagcaaatagacgaggcaacggccttggttcaaagtcatgtggttcctcatgatacgttg
actgatttaaccgaagatgttcaaaacacccaagtggttaatatagtgcaggaaatgtta
caaagtatcactcaatcgcagagcaatgttcaagattcagaaaagccaatggatcagcag
ctaaagcccgacaccaaacaggccgatttaaacattggagaaatgtcgtcggtcgaaata
tctcaaactgtttcagatgaaaaagagggacgatttgtgcctggagaactgcccgaagaa
aagtctagcttatccattatgccccatcactcgctagtaagcagtgaagtgcaatcaagt
gatgatcttgcacaattagcacttatttcacctaaggaaacattagccgaaataattcgc
gatgagctaactgcgattagtactcacgaacagaaaactgaagaaaaagaggtgccattt
accgaccagcctgcagtagcttctacagccgaccgtacaataatgcctactcagtccgtt
aacattactgaaattatcactcaagatagtgaaacaattttgcacaagtccatacctcta
gaagcacaagctgaggagagtgttctactgcaggaagctactgaaatccgtgaaaccaaa
agcgaacaagacatagatttactgaaaattgaacaacctcaggattatcaggcctcacta
gaaacgttgccgcttacatccattacagttacagaaaatgtctcggtggagaaagaatca
gaacatgtaaaagataaatcacctctattaagtaaagctgatacaaatttggaaaatgcc
aacaaggtggcaagcatatctgagatattaactaaccagctggaaaaggatatgatgcca
gaccaacctcaagaaggcaaagcggttctagaatttacagaacacaacgtcatcgaagaa
gctgacgctaacgcgttagaggcattaggtaaatacaacaaagacagcaaactgactact
tcccaagtacatgttgatttaacagaagccagacacgtagcaagtgtagcagaagtacta
caaactcaagctgaatctgaatttattccgggcactacaaaaacagagttagcctcagaa
gcaatttcagaacacaaagcaatcgaagagttacaaattcgatgtctagaagctttgggt
gaaaaacccaaagctgaaagcccagaatcatttatggctggctacgtgttaccggatttg
gcttccgcagcaaatgtaacagaagttttaagcactcaggctgagtctgaattcactgtt
ccaaaacccaatcaagaaactgcacatccccatttactaggactagaagtggttcaagag
caggaagttagggttcttgaaagtttgggtgatcatgtaagggataagcttccgttatca
ggtattgcggatattaatatggaaaaaagcaatcaagcagtaaacataactgaaatactg
acatgttccaatgaaaccgagttaaaagtgcagcttccttccgacgattttgcctcagtg
actcttatagagcaacggaatattgaagaaactaatgttaaggcttacgaatcgctagct
aagcctgtcagcgaagctgttcccagaacagataaggcagccataaatctagaaaaagct
ggaaaatctgcgagtataactgaaattttacctgctcaaatggaatctgatctggtccaa
gatgttccgaaccaagaaaaagctacttcaaatattttagaaagcaaaccaatcgaagga
ctcgatataaaatctttcgaaaatgttggtgatgacattactacaaagttgcctgacttt
tcccaagctagcctagatcttgaatacacgcgtaatatcgcatctgtatcagaaatatta
agcaatcaacaagaatctcacttagaaagtttcaaagctccaacaagtacagcatcacct
gtgatggatagtttcaaagggctgaaaagtgaggatgtgaacgtgtatgaaaatactact
gaattccatagaaaaaaacatataccgcagcagactgctgcgttacataaggatgagttt
gagagcgttatggaatcaactattacaattcaaggatccacccaacagttggaaattgaa
caccccaacagcaaagttgccgatttcgatatgctgacagagcaaagtattaccgtaacg
caaacgatggcacatggaaccgtaggtgaagaaatttcaactgttatggcaactgaaacc
actgcggaaaaacgagttgaagataaaccagtgggaaccagtgaggatgttcttacccta
gatagcgttaatgtcattaaaccagatcatgttaagaccttaaaagttcaaagtcaatat
gttgacgttaaccgaagccttgtagtaacagaacaaacggtctcaggtagtgttataacg
ttagatctcgaaacacccaatcagaagaatgttacagtggctttgacagacactgaaacc
ccccaactgcagataagtgaagtccagatacttgaacatccaggtgaagtaagtgaagat
ctgcccaaagtcataggtacggtgatccaagatgtaagagaatcagtcactatcgaaacc
gtaatgtctcaaaaaccagtagaagatgttcctttaatcgaagaactaccagaggaaatc
gaagtaatagaggcagtagcagcagatggcaaaaagaagaagaaaataattaagaaaaga
actataagaaaacgtattggggacactcgagaagatacgcatattgtcactatcgaggaa
gaaggaaaactacctcaatccaccgtaactatagaagaaattgaagtaccagatacaaaa
actgatgaatttttgacaccaagtgttgaagaggttccttacattgaagaactaccagaa
gaaataattgagacggaagtagacagtttggaaggacccaagaagaaaacattcaaaaaa
cgaacactgaaaaaacgtcgaggaagcaaagtagaaacgacggaaatattcacagttcaa
gaagaaggcaaagaaccgcagacgtctgttacaattcaagatgtcactgaagaagaaagc
aagcttaccgacgtcctccccgaaaaacaggaaaaagctgtattaattgaagaattgcca
gaagaaattaacatagatgaggtacaaagcaggtggggtcccaaaaaacgaaccactaaa
aagaggataatcagaaaacgggtcggcgataaacaggaagaaactcaaatcgtcacggtc
gaagaggaaggcaaagaaccattgacaacggttacaattgacgaaatcgatttaccttca
gataaggtacgcccattgcaaatattaaaaccggatgaggatgttgcgatagaagaaatt
ccagagcaggtcattattaccaccgttgatacattagaagggcctaagaagaaagttatc
aagaagaaagtgttcaagaaaaaggtcggggataaggaacaagctacggaaatactaacc
gtggaagaagaaggaaaaccgcctgaagtatcagttgtagttaaagaaacggtcgaagaa
gagaagaaagtaaaaaaattgaaaaaacctaaaaaagccacaagcgaacaagttcaagtc
accgaagagggatatttatttgtaccaagtttagcccaagaaaaaattaaagctgaagga
gtggaagacatgattcaaatggaattgttaaaaacagcactgtcaaaacaaattccatca
ttcttacccggagaggatgaagatgaagttgtagaagaaacggtaagcaaaagaaaaatc
aagaaaattattaaaaagaaaaaaccaaagattgaagatctcgatattgaatcgccactt
atcgcagaagaactgccggaagaaatacaggtagttgagacagtaaacaaagaaggtata
gcggagaaaaaaataattagaaaacgagtcataaagaaacataaaggtgatatagatgaa
atcacaacaatcagtacggtcgaagaggaaaataaagtgccccaaagcaccatcacaatt
gaggaagtagaagcagagacagaaaaaccaagtgaaattgattttgatcaggtagtgatt
gtggaagagatacctgaaatgattgaattagtgaaaggtccactagaggaatctagaaaa
agaattatcaaaaagagggtaatcaagaaacggcgaggaagtaaacaagaaaataccgaa
ctaattgtcgttgaggaaggtgaccaaatgcctcaatctacagtaacaattgaagaaatc
gaatttccagaagaaatcgtgaaaaaacttcccgattcagaagagcaatatgtaatcagt
caagacctgcctgaacaggttcaattatttgagaatgagcagcaaaagaaaacggttacg
aaaaaagtcacaaaaacgcgcaaaggaagcaaacaagaaacaaagcaggtattcacaatt
gaggaagaaggtacaaaaccaattacatctactattattgaaaaagttgacttacctgag
gaatttttggagaaactgacaattccctctatggaaaaagcgaaaccggtgtttgctgaa
gatctcgatactgctgacattgtggaagtttctaccaaagaactgcaaaagaaaaaggtc
attaaaaagaagattgttaaaaaggaatcaacagaccaaagaattactgaagaaagccaa
aaaccaattattgcggaagaactaccggaagaaattcatatcatacacgaagaaggaggt
ccggataaaattgtcaaaaaaagagttatccgcacaagaaaaggcaataaacatgaaata
acccaaattttcactgtagaagaagaaggcaaatcacctataacatcggttgtcatcgaa
gaaatcgaatatccagatgagattctcgataaaatacccgaaatccaacctgaaaagtcg
gtgattattgaagaaattcccgatcaaattgaagtaagagtcgttgaaactagcgaaggt
ccacaagaattcattaccagaaagcgagttattaaaagaagaaaaggaagcaaacaagaa
acaactgaagtcgtggttgttgaggaaaatggcaaaccgttgcagtcatcggtcgtgatt
gaagaaatcgatataccggaagatattctagatacgctgcctgaacatacagagcaactg
gagccagtcatcattgaggaattgccagaggaggtgcaggttatagatgcaaagaaaact
attaaaaagaaagtaactaaacgacgcaaaggaagcaaacaagaaattactgaacacctg
accgtactagagcaaggcaagaaaccccaaacatctgtggtcattgaggaaattgaaata
ccggatgacgtgctagaagaattaaaagcacctacaacaataactaaaaaaccaattttt
gtagaagatgttaccgatcagataattgttcaagaaacccaaactgaagaagcacctaaa
agaaaagtaatcaaaaagaaaattgtgaaaaaaccggaagagcttccacaagatgtagtc
ttggcgcgagaactgcctgaagaaatcaccgtactagacgaaggaagaaaaatagttaaa
aagagggtaattaaaacaaagaagggcgacaagcgagaaatcactagtatccttacagtg
gaagaagaaggtaaggagccccagacatctgtattaattgaagaattatcaaaggaagac
atacaagacatacctgaggagtatgtgactatcgaagtaactccagaagaaactcatgtt
atagaagaggacacccctgaaggcaaaagaaaagttactcttaggaagaaagttatcaag
aaaaggaaaggagacaaacaagaatccactgagattgttgttagggaagaagaaggcaaa
cttcctgaaacaagtgttgtaattgaagaagagaccagtccagacgaatttgtcgctgaa
ttagaacctataataattgaagaaatgccagaacaagttcaggtacaagataccaaaata
gttaaacggaaaataactaagaaacgaaagggtagtaaacaagaatctactttgacggta
actgttgaagagcaaggccaggagcctcaaacaactgttgaaatctacgaaattgaaata
ccggatgaagtcacggagaaatttacattaccctcagtcgattccaagaagccctatttc
atagaagacattccggaagaaacagttgaaataaccgaaactcaagtacaagaaggtccg
aagaaaaaagtaattaagaaaaaaataaccaagaaagacatacctaaagttcgaccagaa
tctccagaactcattcctgacaacgaaacgatccttatcacggaacttccagaagaaatt
aaaattgtaacagatgaaagtgggccaacaaaaattacgaaaaaacgtactattaaaaaa
caaaaagatggcaaacaggaaatcactcacattattactgaagaagaagtgggaaagaaa
cctcaaactacagttacagttgaagttattgaagctcctgaagaaatacctaaggaatat
cctgcatacatcgaagaactgcctgagcaaatcgaagttgaagaaaccaagagtaggtgg
ggtccaaagaagaaaactacaaagacacgaacaataaggaaagttaaaggtgacctacag
gaagatacgcatatagtcacaattgaggaagaaggaaaagaaccacagacatcaattatt
attgaagaaaaaactattccgcttgatctggcaatgcccaagtttgaaaaaccagaagaa
gccattatcgaattacctgaagagatcaaagtcatcgaaactataactcctgaaggtgtg
aaacaagaaaagattaaaaggcgtgttatcagaaagaaaaaggggcaaaaagaagaacaa
actgaaatcattactattgaggaagagggcaaaaaacctaaaaccactatatctgtaaca
gaagaggagattcctatcgatacggtaaaagaattggtaggacctactccaatggaagct
tcaatgacttatatccacgaactgccggaagaaattgaagaacaagaaataatcgatgac
aaaggaaaaccaactaaaaaaattactcgaaaacgagtaataaaaaaacctaaaggcgat
aagcaagaaattaccgaaataactgtaactgaagaagaaggtaaaccaacacagacaact
gtgactgttgaagacgttcctttaattgaagaaaaagtaccaagaaagaaaataagtaaa
aagaaggaaatcgataaacccaaaaaactacgaagagaagtatcagtattactccctctt
gtaattaaagaagtgaagttcgaaaaagtcaaaattgttgatgcaaaggatgtgccactt
ttcggcgaagtcaagctaaggaaaccaaagaagatttcgcaaaagaaagatacaacaact
aaagttcaaattccaaggctgaaaagtagaataaatcatataacgttcccacccttaaca
gaaatagaacaactacctcgaatttctattttagaacccatataccgggacaatggaatc
ttatctcgtaacatcaaggaagccgaaaaattaccgaagacgaagcgacgtcggttaagg
gacaaggatgttattgggaaaagtttggaaaaactagacctggaactggaagatcttaaa
aagaaagagcttgaaaaacttgatgatgaatataaattcgaaaagaaaccacgcaaaaaa
ccggcaagcaaggaagaactgcaacccattaaacttggcaagggctccgttgaacaaccg
tctgaagatgatgaaactgtcaaattaaagaaggttccactgaaaccccaggatattgaa
gaacaaactgaattgaaacctgtgaagaaacctgacacaataaaaaagaaagacaaaaag
cggccagaaaaggactcagaaaaaattgtttttgaaccctatgacgtggactacgaacaa
cccgaactagataaatatgaacctacaaaacctaaagaagaagaagaagacaaaacagta
cccaaaaaagttaaagccgttcgaaaaaataaagataaacaagcacctgaaacggaacca
gctattattgaaccgggagttcccaaaacaattgaaggggaagaacaacccgaagtaaca
ctgaagtatgctagaaagccaaaaccagaagaagaatctgaagaaattaggctaaagcca
catagaaaactagatgatgatgaggagttcaaagtggaaatcgaccaggtgatgaaacat
gatgctataattactttcgaaggcccagatattgaacaagacattaaatttgatgatgat
actgaaaagcctcaatcaagaaaggtagtaaagaaaataaagaaaaaggttcagaaaggg
caatcagatttggaagaaataatacctcaagatgccgaagttttaactgtggaagaagaa
gttgtcgaggacattccccagctccaacaaccattagaactgaacgaaatagaaattcca
gaaataattccatccgaagaagataaatctgccataaaaaagaaaaagaaaacagtaata
aaaagacggcctcgaaaagaaggttcggaagagatagcagaacagtccgaagaatttcca
gtttcagaagaagaggaactgcaagttgaagaaaaagaagttaaaataattaaaaagaag
attcctaagactaaacctgaagaaacaccaagtcaagcacctgaagaaaagctagaaaaa
cccaaagatattgaagaccagaaaccagttgaaactccggaaaagaagaaacccaaaaga
gtaattccgaagaaagaagaagtgaaagaaaaaattccacgactaaaaagtagaatcgta
catgtaccatttccacctgaaaacgaatcagagcgaattccggaaataactcagctccca
ccagtatatcgagacaacggtattctttcgcgcagtataaaagaagccgaaaagcttcct
aaaaagaaaaagatcaggattaaggattacgaaagagatttgaaggacttggaaaagctt
gatttagaagttgaagatttaaaaaagagagagttggagtcactcgataaagatttattc
gcaaaacctaaaaagactaaaaaatccgaaaaacctgctgcgccgaaaaaacttgaaatt
ggaaaaggtgagataccagacaaaaataaacctgatgaagaaatcgttcttaagaaagtc
cctgataagttaataaaagaagatgaagaagatgtaaaaaagccaaaatcaaaggagaaa
aaagacagacttgtagctcctaaaaaagacgaaagaaatgtagagggcaccccatttgaa
ccttacgatattgaaagagagtccccggataaagaagttcttgaattgcctgaacatgag
gaagaagaggatattcccaagagtaaagaaaccgttaaactacccaaacggaagaaggtt
aaacctacccccgaaagcattgaacaggaattaaaaccaggcattccgaagccaaaagaa
gtagaagaagcgcctgaaattactctaaaaaaaaattga

DBGET integrated database retrieval system