KEGG   Desulfotalea psychrophila: DP1823
Entry
DP1823            CDS       T00192                                 

Name
(GenBank) Pyruvate formate-lyase 2
  KO
K20038  choline trimethylamine-lyase [EC:4.3.99.4]
Organism
dps  Desulfotalea psychrophila
Brite
KEGG Orthology (KO) [BR:dps00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DP1823
Enzymes [BR:dps01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.4  choline trimethylamine-lyase
     DP1823
SSDB
Motif
Pfam: PFL-like Gly_radical Reo_P9
Other DBs
NCBI-ProteinID: CAG36552
UniProt: Q6AM73
Position
2060479..2063019
AA seq 846 aa
MDLQSFSEKLIVATKNLNAAERASLKKIFDGDSTEIAEDKNVPSAHLSVDPCAIPNGPTD
RHIKLKKKFLTHVPTITTHRARAITKIAQENPGLPKAILRGKSFKYCCETAPLVIQDNEL
IVGSPCGAPRAGAFSPDIAWRWVKDELDTIGTRPQDPFFISEEDKKIMREELFPFWEGRS
IDEYCEQQYREAGMWELSGESYVTDCSYHATNGGGDSNPGYDVILMKKGMLDIVRESQEK
LAELDYENPDDMDKIYFYKSLIDTAEGVMIYAKRLSDYAAQLAASEKDPQRKAELEKISA
VNARVPAHKPETYWEAIQAVWTVESLLIVEENQTGMSIGRVDQYMYPFYKADIEAGRMTE
YEAFDLSGCLLVKCSEMMWITSEDASKFFAGYQPFVNMCLGGVTREGLDATNDLTYLLMD
AVRHVKVYQPSVSTRVHNQSPQKYLKKIVDVIRAGMGFPAIHFDDAHIKIMLAKGCSIED
SRDYCLMGCVEPQKSGRLYQWTSTAYTQWPICIEMALNHGVPLWYGKQVCPDLGALESFD
TYEKFDAAVKEQIKYVTKWTSVGTVISQRIHRDLAPKPLMSMMYEGCMESGKDVSAGGAM
YNFGPGVVWSGLATHADSMAAIKKLVFDDKKYSLTQLNEALKAEFKGYDQLKADCLAAPK
FGNDDDYADLIVNDLVNFTEREHRKFKTLYSVLSHGTLSISNNTPFGQLLGASANGRDAW
MPLSDGISPTQGADFKGPTAIIKSVSKMPTDSMNIGMVHNFKLMSGLLDTPEGENGIITL
IRTASMMGNGEMQFNYLDNDTLLDAQLHPEKYRDLVVRVAGYSAFFVELCKDVQDEIISR
TMLTEI
NT seq 2541 nt   +upstreamnt  +downstreamnt
ttggatcttcaaagtttttctgaaaaactcatagtagcaaccaaaaaccttaatgctgcg
gagcgcgcctccctgaaaaagatcttcgatggtgattccaccgagattgcagaggacaag
aatgtgccatcggctcatctctctgtagacccatgtgctatacccaatgggcctactgat
cgacatataaagcttaagaaaaaattccttactcacgtgcccaccatcaccacccatcgg
gctcgggccatcaccaagattgctcaggaaaacccaggattgcccaaggctattctgcgc
ggtaaatcctttaagtactgttgtgaaacggcacccctggtaatccaggataatgagctc
atcgttggttctccctgcggtgctccccgggccggtgccttctcgccagatatcgcttgg
cgctgggttaaggatgaacttgataccatcggcactcgtcctcaggatcccttctttatc
tccgaagaggataaaaagatcatgcgcgaagagctcttccccttctgggaaggccgatcc
attgatgagtattgtgagcagcagtaccgcgaagcgggtatgtgggaactctccggtgaa
tcctatgttaccgattgctcttatcacgccacaaatggcggtggtgattctaatcctggc
tacgatgtaatcctgatgaaaaagggtatgcttgatatcgtcagggagtctcaggagaag
ttggccgaactggattatgaaaatcccgatgatatggataagatctatttttataagtct
cttatcgataccgcagaaggggtaatgatctacgccaagcgtctctctgactatgcggcc
caattggcagccagtgagaaagatccccagcgtaaggcagaacttgagaagatctcagct
gtaaacgcccgggttcctgctcataagcccgagacctattgggaggctattcaggcagtc
tggaccgttgaatctcttcttatcgttgaagagaatcagacaggcatgtccattggtcgt
gttgatcagtatatgtacccattttataaggcagatattgaagcaggacgcatgaccgag
tatgaggcctttgatctctccggttgtctgctggtgaaatgttccgagatgatgtggatc
accagtgaggatgcctccaagttcttcgctggctatcaacccttcgtcaatatgtgcctg
ggcggggtgacccgcgagggtcttgatgccaccaatgatcttacctacctccttatggat
gccgttcgtcatgttaaggtttatcaaccctctgtgtccacccgtgttcataaccaatct
cctcagaagtatctgaagaagattgtggatgtgattcgtgccggcatgggctttcccgcc
atccacttcgacgatgcccatattaagataatgctggccaagggctgctccattgaagat
tcccgtgattattgcctcatgggttgcgtagagcctcagaagtctggtcgtctctatcag
tggacttccaccgcctacacccagtggcccatctgtattgagatggctctcaaccacgga
gtgcctctctggtacggcaagcaggtctgtcctgatcttggcgccctggagtcctttgat
acctatgagaaatttgacgcggccgttaaggagcagatcaagtatgtgaccaagtggacc
agtgtcggtaccgttatttcccaacgcattcaccgggatctggctcctaaacctcttatg
tctatgatgtacgagggttgtatggagtccggtaaagatgtctcggcaggcggtgctatg
tataactttggccccggtgttgtctggagtggccttgccacccatgccgactccatggca
gctattaaaaaactggtctttgatgacaagaagtacagcttgacccagcttaatgaagcc
ctaaaggccgagtttaagggctatgaccagctgaaggccgattgtcttgccgctcctaag
tttggtaacgatgacgattacgctgatcttatcgttaatgatctggtgaacttcaccgag
cgggagcatcgtaagtttaagaccctctattcggttttgagccatggtaccctctccatc
tctaataatacgccatttggtcaactccttggtgcttcagccaatggtcgtgatgcctgg
atgcccctctccgatggtatcagccctacccagggtgctgactttaaggggcccaccgcc
atcattaagtccgtatcgaaaatgcccaccgatagcatgaacatcggtatggtgcataac
ttcaagctgatgtccggtcttttggatacacccgaaggtgagaacggtatcatcaccctg
atccgtactgccagtatgatgggtaacggtgagatgcagtttaactatctcgataatgac
accctgcttgatgctcagttacatcctgaaaagtatcgtgatctggtggttcgggttgcc
ggttacagtgccttttttgttgagctgtgcaaggatgtacaggatgaaattatcagcaga
accatgttgactgaaatttag

DBGET integrated database retrieval system