KEGG   Desulfotalea psychrophila: DP1725
Entry
DP1725            CDS       T00192                                 

Definition
(GenBank) probable oxidoreductase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00230  Purine metabolism
dps01100  Metabolic pathways
dps01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DP1725
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     DP1725
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CAG36454
UniProt: Q6AMH1
Position
complement(1940436..1942814)
AA seq 792 aa
MGRSKMSKLRSIAVPVRQKDGRARVTGEAKYYADYLFQGMLQTRILRSPYPSADIISINI
EKAEAIAGVRLIMTHENFPKAFRGSLYYVGDLVAAVIADTKEIAEAARALIEVEYDKKKA
VLSLEDAIKPGAPQVFAGEDNCHDWEFHAQLSDQDPETGLYKTKTPSDYNGFGDIEQGFA
ESDVIVEMKDLKYAYTKSPAMETRGCTVNYDGARLQVYTHSQGMHDEKYSLAQALGIGSD
KVNYISPYTGSSFGGKNSNVLDRNLPSHYLLIASLACLQLKKAVHCAYSREEEMICSWSR
GSQADVKIGFKKDGTMVAMDYSHWQETGAGGDKYPAKNAMLATGAVLYSHNCKHLRGKIR
YVNTNRFPAVGWQGYGAPEGTYAVEVTMDVAAEKLGMDPIEIRKKNCMRTGDIDAGWDPL
EYKSAYVSSAAIRECLDIGAERLDWQNSWQHPSKKSGRIRSGMGVGIFAMGAGRPGVGNS
SEAMVKIFPDGSAALVCAIADIGQGQHTVQCQITAEVLGLPYEKVGIVCQDTDSTPFATL
VANSCGTWIQGWATYEAALDAKRQLLKIAAPILNVQAEELALSEQGIYVVAEPERLISFA
EAFGSIGHYGGRHEIIGYYCNNSPHDRCLKDGKKDEVYIPKEKGAQFVSLDIDTETGMMD
NVKVYMIQDVGKALNPKIVEGQLLTCRHGVENAMLGNDCIVDKRNGWLMTPNFIDYRPAT
SLDCDVVPIIVENPGDPTHPFGATACGEGAACPSLAAFSNAIYNAIGVRLIETPFTPDKI
LNALGKIKGRKK
NT seq 2379 nt   +upstreamnt  +downstreamnt
gtggggaggagcaaaatgagtaaattacgttctattgctgttcctgttcgccaaaaagat
ggacgggcccgagtgacaggtgaggcaaaatactacgctgattacctctttcagggaatg
ctgcagacccgtatcctgcgaagcccctatcccagtgccgatattatctctatcaatatc
gaaaaggcggaggctatagctggtgttcgccttattatgacccacgaaaatttccccaag
gcctttagaggaagtctctactatgtgggtgatttggtagctgctgttatcgccgatacc
aaagagatagccgaagccgcccgggcgcttattgaagtcgaatacgataagaagaaggct
gttttatcccttgaggatgccataaagccaggagcacctcaggtatttgcgggagaagat
aactgccatgattgggagttccatgcccaactcagtgatcaggacccggaaacaggactc
tacaaaaccaaaacccccagtgattacaatggatttggtgatatagagcagggctttgcc
gagtccgatgtcatagtagagatgaaggatctcaagtatgcctacaccaaaagtcctgcc
atggagacacgtggctgtacggtaaattacgacggtgctcgcctccaggtctacacccat
tcgcagggaatgcacgatgagaagtacagtcttgctcaggccctgggaattggttcagat
aaggtgaactacatctctccatataccggttcaagttttggaggcaaaaactcaaacgta
cttgaccgcaatcttccctctcactatctgctcatcgcctccctggcctgtctgcagctg
aaaaaggccgtacactgtgcctattcccgtgaagaagagatgatctgttcttggtcccgc
ggcagtcaggccgatgtaaagattggctttaaaaaagatggcaccatggtcgccatggat
tattcccactggcaagaaaccggggccggtggagataagtatccagccaagaatgccatg
ttagccacgggtgcggtactctactcacataattgcaagcatctgcgtgggaagatccgc
tatgtcaacaccaaccgttttcctgcagtgggatggcagggttacggtgcacccgagggc
acctatgccgtcgaggtaaccatggatgtagctgccgagaaactcggcatggatcctatt
gagattcgcaagaaaaactgcatgcgtaccggagatattgacgctggttgggatcctctg
gaatataaatctgcctatgtctcttctgcagccatcagagagtgccttgatattggcgca
gaaagacttgactggcagaacagctggcaacatccaagtaagaaatctggccgaattcgt
tccggtatgggggtaggcatctttgccatgggagcaggacgccccggagtgggtaactcc
agtgaagccatggtgaaaatttttcccgatggttccgcggcccttgtctgtgccatagct
gatataggacaaggccagcatactgtacagtgccaaatcaccgcagaggtacttggtctc
ccctatgaaaaagtggggattgtctgccaagataccgactctacaccctttgccacgctg
gtcgccaatagctgtggcacctggattcagggctgggcaacctatgaggccgccctcgat
gccaaacgccaactattaaaaattgccgcaccaatccttaatgttcaagcagaagaactt
gccctaagcgagcagggtatctacgtggtagcggaaccggaaaggctcatctcctttgcc
gaggccttcggttccataggacattacggagggcgacatgaaattattggctactactgc
aataactctccccatgaccgttgtcttaaggatggcaagaaagacgaggtatatatccct
aaggaaaagggtgctcagtttgtcagccttgatatcgataccgaaactggcatgatggac
aatgtgaaggtgtacatgatacaggacgtgggcaaggccttgaacccaaaaatagttgaa
ggacagctgctcacctgtcgccatggggtagaaaatgccatgctaggcaatgattgtatt
gtcgataaaagaaatggttggctaatgaccccgaatttcatcgattatcgccccgcgacc
tcccttgattgtgatgtagttcctattatcgtagaaaatcctggcgatcccacccaccca
tttggggcgactgcctgtggtgaaggtgcggcctgtccatctctggctgccttttccaac
gccatctataatgcaatcggtgtacgtcttatcgaaacaccgtttaccccagataaaatt
ctgaatgccctaggaaaaataaaggggagaaagaaataa

DBGET integrated database retrieval system