KEGG   Desulfotalea psychrophila: DP2531
Entry
DP2531            CDS       T00192                                 

Gene name
coxL
Definition
(GenBank) related to aerobic-type carbon monoxide dehydrogenase, large subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00230  Purine metabolism
dps01100  Metabolic pathways
dps01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DP2531 (coxL)
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     DP2531 (coxL)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CAG37260
UniProt: Q6AK66
Position
complement(2882406..2884739)
AA seq 777 aa
MSKFKVVGQNIKRRDGVDKTTGRGLFTSDMSLPGMLHAKVLRSPHPHAKIVSIDVSAAEK
MIGVRAIMTHENGPKNLFNAAAPMFLTAPHLERVLDQYLFDDIVRYVGDEVAAVAATTEA
IAEQAIKLIRVEYEILPAVLDLEEAMGPDAPELHGDKGCTPEGKNIPGEIIRIPYGDIEK
GLAESEVIIEKSFKLPIVKQVQMETQSAVAQVDGNGEVTVWSTTQTPHPTKAILGKIFAM
PASKIRVLAPPYVGGGFGVRIGLSGLAEPIAMALAMLAKKPVKLVYSRKEDFIASDTRHP
AVVTVKLGADRDGTFRALDVKALFGTGAYCSFGAELPGVCGAMTLAIYRIPHQRYYGHSV
YTNQTIGGAMRGFGNPQGNLALEQVVDLMAIELGMDAYELRMKNITQVGDKWCLPFPCLS
SELAECMRQGAESIGWKRRGSLNSPGSKKVRGLGMAVGTHVSNAWPFCVDYDNAYVTIQS
DGTANVASGVPELGTGVCTSLVQIAAETLSMDVDKISLTYGDTQSTPFDIGSHASRTCYA
AGLAIQIAATDAKKQMLEYAAPLFSVTPEDLQIKDDRVELVDATVASEHCSLDDIAGGKG
NSVTLEELVYHAHVRNKQFIGVARNVPANAAPWHACFAEVEVDKETGQVEVIKLAAAHDV
GTAINPMIVEGQIEGGAVQGIGYALTEEIRYNNRGGQVNSSMHNYMLPTAEDIPPIDAII
VEASDPTGPFGAKGAGECSLVCPASAIANAVADATGIRFVELPITPERVFAALHLEN
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgagtaaatttaaggttgttggccaaaatatcaagagacgtgatggggtggataagacc
acgggcagggggctttttaccagtgatatgtccttgccgggtatgttgcacgcaaaggtg
ttacgcagtccccatcctcacgctaaaattgtcagtattgatgtttcagcagcagaaaag
atgatcggtgtccgggccataatgacccatgaaaatggacctaaaaatctgtttaatgcg
gccgcgccaatgtttcttaccgctcctcatcttgaaagagttctggatcagtacctcttt
gatgatattgtccgttatgtgggcgacgaggttgctgctgttgccgccaccaccgaggcc
attgccgagcaggcgataaagcttattcgggtggaatatgagattttgcctgcggttctt
gatcttgaggaggccatgggcccggatgctccggaattgcatggtgacaagggatgtacg
cccgagggcaagaacattcccggtgaaatcatcaggattccctatggtgatattgagaag
ggcttggcggaatctgaggtaattattgagaaatcctttaagcttcccattgtcaagcag
gtacagatggagacccagagcgccgtggctcaggttgatggtaacggtgaggtcactgtc
tggtctaccactcagactccccatccgactaaggcaatcctcggtaagatttttgctatg
ccggcgagcaaaatacgtgttttggcacctccctatgtcggtggcggttttggggtgcgt
attggcttgagtggtctggctgaacccattgccatggctctggcaatgcttgccaaaaaa
cctgtaaagcttgtctatagtcgtaaggaagattttatcgcttccgatacacgtcatcct
gccgtggtcaccgttaagcttggtgctgacagggatggaacgttccgggctctggatgtg
aaggctctttttggtacgggcgcttactgtagctttggggcagagcttcccggtgtttgt
ggggcaatgaccctggccatttaccgcataccgcaccaacgctactacgggcacagtgtt
tataccaatcagactattggcggagccatgcgtggctttggtaatccacagggaaatctg
gcccttgagcaggttgtggatttgatggccattgaacttggtatggacgcctatgaattg
cggatgaaaaatatcacgcaggttggagataagtggtgtctacccttcccttgtctgagc
agcgaacttgcagagtgtatgcgacagggagcggagagtatcggttggaaacgtcgcggt
agcctgaacagcccgggcagcaaaaaggtgcgtggtttgggaatggccgttggtacccat
gtaagtaacgcttggcccttttgtgttgactacgacaatgcctatgtgacaatccagtcc
gacggcacagccaatgttgcctctggtgttcctgaattgggaacaggggtatgtacctca
ttggtacaaattgctgctgaaaccctgagtatggatgtagataaaatttcactgacctat
ggtgatacccagagcacgccttttgacattggcagtcacgccagtcgtacctgttatgcc
gccggattggctattcagatagctgctacggatgcaaagaaacagatgctggaatacgcg
gcccccctttttagtgttaccccggaagatctgcagataaaggatgacagggtagagtta
gtggatgctacggttgcctcagagcactgttcgctggatgatatagcggggggcaaggga
aattccgttacccttgaagagttggtttatcatgcccatgtccgtaataagcagtttatc
ggtgtggcaagaaatgtaccggcaaatgccgccccttggcatgcatgttttgccgaggtc
gaggtggacaaagagacaggacaggttgaggtgattaagcttgccgccgcccatgatgta
gggactgccattaatccgatgattgtagagggacagattgagggaggggctgttcaaggt
atcggttacgccctcactgaagagattcgctacaacaatcgtggcggccaggttaacagc
agtatgcataattatatgctacccacagcagaagatattccccccattgatgccattatt
gtggaggcaagtgatcctactggccccttcggcgccaagggggccggagagtgtagtctg
gtttgtccggcatcggcaatcgccaatgccgtggctgatgcaaccggcattagatttgtt
gagttgccgatcaccccagaacgagtgtttgcggctcttcatttagagaattag

DBGET integrated database retrieval system