KEGG   Danio rerio (zebrafish): 100037391
Entry
100037391         CDS       T01004                                 
Symbol
cop1
Name
(RefSeq) E3 ubiquitin-protein ligase COP1
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04115  p53 signaling pathway
dre04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100037391 (cop1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100037391 (cop1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dre04121]
    100037391 (cop1)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100037391 (cop1)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100037391 (cop1)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100037391 (cop1)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 WD40_like Prok-RING_4 zf-RING_10 zf-rbx1 UvrD-helicase zf_C2H2_10 Terminase_2 DUF4560 zf-RING_4 DZR
Other DBs
NCBI-GeneID: 100037391
NCBI-ProteinID: NP_001083011
ZFIN: ZDB-GENE-070410-134
Ensembl: ENSDARG00000079329
UniProt: A4QP94
Position
2:35116550..35138020
AA seq 694 aa
MSSTRQQQQQQSGGPAGSVPGTSSGSLCSLSSSGGTGGANSGNSAAQNGSSSGNGVSSRT
LGSVADGQSARLGSLSRKRPLYNGLINPYEDKSNDFVCPICFEMIEEAHMTKCGHSFCYK
CIRQSLEDSNRCPKCNYIIDNVDQLYPNFLVNELILKQKQRSEEKRLKRDHPNGTKWQVF
QDVLGADQENMDLANVNYILEYLLQKKKQLEAESQAAQRQILMEFLKEARRNKREQLEQL
QKELNFLEEDIKRVEEMSGMYSPISDMDCNSDSTVPQVEAPSPAPSSSIIDPSEYIQPPF
GGNSQSKRQTWYNSTLASRRKRLTAHFEDLEQCYFSNRMSRITDDSRTVNQLDDFMECLS
KFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVFEYGTVIQDA
VDIHYPVNEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCW
SVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPTSRYHLAFGCAD
HCVHYYDLRNAKQPIMVFKGHRKAVSYAKFVNGGEIVSASTDSQLKLWNVNKPHCLRSFK
GHINEKNFVGLASNGDYVACGSENNSLYLYCKGLSKTLLTFKFDTVKSVLDKDKKEDDTN
EFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgtcaagcactcggcagcagcaacagcagcagtccggtggtccagcgggttccgtccct
gggacaagctccgggagtttgtgtagcctcagcagcagcggcggcaccggcggagcaaac
agtgggaacagcgccgctcagaacgggagcagctcgggtaacggggtgtcctcgcggact
ctgggctcggtagccgacggacagagcgctcgtctgggctctttaagcaggaaaagaccc
ttgtataacggtcttatcaatccctatgaagacaaaagtaatgattttgtatgccctata
tgttttgagatgatagaggaagctcacatgacaaagtgtggccacagtttctgttataaa
tgtatacgacaaagtttggaggacagcaacagatgcccaaaatgtaattatataattgac
aatgtggatcaactttaccccaacttcttagtgaatgaactaatcttgaaacaaaaacag
agatctgaggagaagcgtctaaaacgggatcaccctaatggaaccaaatggcaagttttc
caggatgttcttggggctgatcaagagaatatggatttagcaaatgtcaactacatatta
gagtacctgctgcaaaaaaagaaacaactggaggcggaatcacaagctgctcagcgacag
atcttaatggagttcctgaaggaggccagaagaaataaaagagagcaactggaacagtta
caaaaagaactgaactttttggaagaggatattaaacgagtggaggaaatgagtggtatg
tactcacccataagtgatatggactgcaattcagacagtactgtgccacaggttgaagct
ccctctcctgcacccagcagtagcataatagacccttcggaatacattcagcctcctttt
ggtggaaactcacagagtaaaagacaaacatggtacaacagcactcttgcatcacggcgg
aagagactgacggcacactttgaggatctggaacagtgttatttctccaataggatgtct
cgaataacggatgacagcaggactgttaaccagctggatgatttcatggagtgtctatca
aagtttacccgttacaactctgtgaggcctctggccaccctctcttatgctagtgacctt
tataatggctccagtattgtgtccagcatcgagtttgaccgcgactgtgattacttcgcc
attgccggtgtcactaagaaaattaaagtgtttgagtacggcactgtgatccaagatgct
gtggacattcattatcctgtcaatgagatgacatgtaactctaaaattagctgcatcagc
tggagcagctaccacaaaaacctgttagccagcagtgactatgaggggactgtcattctt
tgggatgggtttactgggcagaggtcaaaggtctaccaggagcatgaaaagcggtgttgg
agtgtcgatttcaaccttatggatcccaagctcttagcgtcgggatcagatgacgcaaaa
gtcaagttatggtccaccaacctggacaattcagtagccagcattgaagccaaggccaat
gtatgctgtgttaagttcagtccaacctctcgatatcatcttgccttcggttgtgcagac
cactgtgtgcactactatgacctgaggaacgctaagcagcccatcatggttttcaaaggc
cacaggaaagcagtatcctatgccaagtttgtcaatggaggagaaattgtctctgcctca
acagacagccagctgaaactctggaacgtgaacaagcctcattgtttacgctctttcaaa
ggccacatcaatgagaagaactttgtgggtttggcatcaaatggagactatgtagcatgt
ggtagtgaaaacaactcgctgtacttgtactgcaaaggcctttccaagacgctgctgaca
ttcaagtttgacactgtgaagagcgtcctggacaaggacaagaaggaggacgacaccaat
gagtttgtcagtgcagtgtgctggcgagctctacctgatggggagtcaaatgtgttgatt
gcagccaacagtcaaggaacaatcaaggtacttgagctggtctga

DBGET integrated database retrieval system