KEGG   Danio rerio (zebrafish): 100151570
Entry
100151570         CDS       T01004                                 

Definition
(RefSeq) gastrula zinc finger protein XlCGF57.1-like
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf_UBZ zf-C2H2_jaz HypA zinc_ribbon_15 Zn-ribbon_8 zf-RING_7 zf-C2H2_11 C1_1 zf-C2HE DUF3268 zf-H2C2_5 zf-LYAR
Other DBs
NCBI-GeneID: 100151570
NCBI-ProteinID: XP_005174058
UniProt: A0A286Y9A0
Position
22
AA seq 447 aa
MNEPCSIKLEETEQQIDPLKDDEKIEELIKSEKDHTDVKTEEKSSLQSTAKISFTCPQCG
KTFPCEQNLNLHMKFHRGAKPFACDKCEKIFTLKANLNEHMKTHTAVQMPFTCVQCRKIF
MLKESLSEHMKIHTKEKPYTCDECGRKFKHKGTLTEHRKIHTGEKPYECEKCGKKFRHKG
NFNDHVKNHTRIKPFSCDQCGKCFRLKDNFDDHMKVHTGGNPHTCAQCGKTFKQKHVLNE
HLIIHTGEKPFTCEQCGTSFTRKRNLADHMTIHTGENLYACDQCGRSFRQSRVLKEHLRT
HSSERPFNCDQCGKKFFKADALKEHLTVHTQEKPYVCSFCAKAFRLIGNLKIHEKTHTGQ
RNHICSECGKTFFTVSALTLHTRVHTVGKPYKCSHCDKTFKRPECLKIHYRVHTGERPYH
CRSCGKRFIYLSNLHQHLKAAKCKKTQ
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgaatgaaccctgcagtataaaactagaagagaccgaacaacaaatagacccgttgaaa
gacgatgagaagattgaagaactgattaaatcagagaaggaccatactgacgttaaaacc
gaggagaaatcctctttgcaaagtacagcaaagatatccttcacctgtcctcagtgtgga
aaaactttcccatgcgagcaaaatctcaatcttcacatgaaatttcacaggggagcgaag
ccgtttgcgtgcgataagtgcgagaagatcttcacactaaaagcaaaccttaacgaacac
atgaaaacccacacggctgtacagatgccgttcacatgcgttcaatgcaggaagattttc
atgctgaaagaaagcctctccgaacacatgaaaatacacactaaggaaaagccgtacaca
tgtgatgagtgcgggaggaagtttaaacacaagggcactcttactgaacacagaaaaatc
cacaccggagagaagccgtatgaatgcgagaagtgcgggaagaagtttaggcataaagga
aactttaacgatcacgtgaaaaaccacacacgaatcaaacccttctcttgtgatcagtgc
gggaagtgtttcagactcaaagataacttcgatgaccacatgaaagtccacaccggaggg
aatccacatacgtgtgctcaatgcgggaagacgttcaaacagaaacatgttctcaatgaa
cacctgataatccacaccggagaaaagcctttcacgtgcgaacagtgcgggacgagtttc
acaagaaaacgcaaccttgctgatcacatgacaatccacactggagaaaacctgtatgct
tgtgatcagtgtgggaggagtttcagacagtcgagagtgttaaaagagcatttgcggact
cattctagcgaaagaccgtttaactgtgaccagtgcggtaagaagttcttcaaggcggac
gccctgaaggagcacctgacagttcacacacaggagaagccgtatgtgtgctctttctgt
gcaaaggctttcaggctgattggtaatttgaaaatacacgagaaaacacacaccggtcaa
aggaatcacatttgctctgaatgcgggaagactttttttactgtgtccgcactgactctg
cacaccagagttcacactgttggaaaaccgtataaatgttcacactgtgacaagacgttt
aaacggccggaatgtctgaaaatacattatagggttcacactggagagaggccatatcac
tgtcgctcatgtgggaagaggttcatttatttgtctaatctgcatcagcatttgaaagca
gcaaagtgtaagaaaacacaatag

DBGET integrated database retrieval system