KEGG   Danio rerio (zebrafish): 321555Help
Entry
321555            CDS       T01004                                 

Gene name
prpf40a
Definition
(RefSeq) pre-mRNA-processing factor 40 homolog A
  KO
K12821  pre-mRNA-processing factor 40
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    321555 (prpf40a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dre03041]
    321555 (prpf40a)
Spliceosome [BR:dre03041]
 Complex A
  U1 snRNP components
   U1 related factors
    321555 (prpf40a)
 Complex B
    321555 (prpf40a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FF WW Glyco_hyd_101C
Motif
Other DBs
NCBI-GeneID: 321555
NCBI-ProteinID: NP_938170
ZFIN: ZDB-GENE-030131-274
Ensembl: ENSDARG00000058467
Vega: OTTDARG00000026980
UniProt: Q7ZUE4
Position
9
AA seq 851 aa AA seqDB search
MMGPPGIPPHFPPMGMPPMGQRPPSLAPMPPGIMPPMMPPMGAPPIGQMPAMMPPMMPGM
MMPPRLPAASIQPTGPPGVSPVEAAAPAAPGTTSTTSTESSPDEQPKKKSVWTEHKSLDG
KIYYYNTETKQSTWEKPDELKSPAEQMLSKCPWKEYKSDTGKPYYYNSQTKESRWTKPKE
LEDLEAMIKAEENGTADVVAPGTTPALTAQNESSVTVAPVAETEATMATGTIEEQPSHVP
AQVAEVSSDVAVNSTEETPSVETQPSNDVSKEERPELVKKVYKWNTKEEAKQAFKELLKE
KGVSSNASWEQAMKLIINDPRYSALPKLSEKKQAFNAYKVQTEKEEKEEARIKYKESKET
FQRFLENHEKMTSTTRYKKAEQMFGDQEVWSCVPERDRLEIYEDVLFYLAKKEKEQAKQL
RKRNWEALKNILDNMANVTYRTTWSEAQQYLLDNPTFAEDEELQNMDKEDALICFEEHIR
ALEKEEEDEKQKTLLRERRRQRKNRESFQKFLDELHDHGQLHSMSAWMEMYPTISADIRF
SNMLGQPGSTPLDLFKFYVEDLKARYHDEKRIIKDILKDKGFLVEINTGFEDFGSVISSD
KRATTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKEAAFKSMLKQATPPLEPEAT
WEGVRERFLKEPAFEDITLESERKRIFKDFMHVLEHECQHHHSKTKKHSKKSKKHHRKRS
RSRSGSESEEDEYHTKKKKRSTSKSPSEHSSSGESERSYKKSKKHKKKGKKRRHKSGSPE
SEGERERKGREKDKDKENDKSRAKLRGESKQKSPKRKSAKEEGGWDTSGSELSEGELEKR
RRTLLEQLDAP
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgatggggccaccaggaatcccgcctcacttccctccaatgggaatgccacccatgggc
cagaggccgcccagcctggcccccatgcccccgggaataatgccacccatgatgcctcca
atgggcgctccaccaattggacagatgccagccatgatgccaccaatgatgcctggaatg
atgatgccacctcgtctgccagctgcatcaatccagcctacaggaccgcctggtgtaagt
ccagtggaggctgcagctccggctgctcctggaacaaccagcaccacatcaaccgagtct
tcacctgatgaacagccaaaaaagaagtcagtgtggaccgagcacaaatctctggatgga
aaaatatactactacaacacagagaccaaacaatccacctgggagaaaccagatgaactc
aaatcacccgcagagcaaatgttgtcaaaatgcccatggaaagagtataagtcagacacc
ggaaagccctattactataactcccagaccaaagagtctcgctggactaaacccaaagaa
ctggaggacctggaagcgatgataaaggcagaggaaaatgggacggctgatgttgtggct
cctggcaccacccctgctctcacagctcagaatgagtcttctgttactgtggcgccggtt
gctgagacggaggctaccatggcgacgggcaccatcgaggaacagccttctcacgtgcct
gcacaggttgctgaggtcagcagtgacgtcgctgtgaactccactgaggaaacgcccagc
gtggagacccagcctagcaatgacgtttcaaaggaggagagacctgagctggtgaagaaa
gtttacaagtggaatacaaaagaggaggcgaagcaggcctttaaagaactcctgaaagaa
aagggcgtttcttccaatgcatcatgggagcaggcaatgaagctgataattaatgaccct
cgttacagtgctctgccaaagctcagtgagaagaaacaggcgttcaatgcttataaagtc
cagacagagaaagaggaaaaggaagaagccagaataaaatacaaggagtctaaagagact
ttccaacgcttcctggagaaccacgagaagatgacgtcaaccacacgatacaagaaagca
gagcagatgtttggagatcaagaggtttggtcgtgtgttccagagagagaccggctggag
atctatgaagatgtgctcttttatttggcaaagaaagagaaggaacaagctaaacagctg
aggaagaggaactgggaagcactgaagaacattctggacaatatggccaatgtgacgtac
agaacaacgtggtctgaggcgcaacagtacctgctggacaatccaacatttgctgaagac
gaggagctacagaacatggacaaggaagatgcgctgatctgttttgaggaacacatccgt
gctcttgagaaagaggaagaagatgagaagcagaaaactctgctgcgcgagagacgtcga
cagcgcaagaacagagagtcttttcagaaattcctggatgagcttcatgatcatgggcag
ctgcactccatgtctgcctggatggagatgtacccaaccatcagtgccgatattcgcttc
agcaacatgctgggccagccaggctccacgcctctggacttatttaagttttatgtggag
gatctgaaagctcgttaccatgatgagaagagaatcattaaagacatcctgaaggataaa
ggtttcctggtggagatcaacacaggctttgaggactttggctcagtgatcagctctgat
aaacgcgccaccacgcttgatgcgggaaacatcaaactggccttcaacagtttgcttgag
aaggctgaagcacgagagcgggaaagagaaaaagaggaggccagaaagatgaagaggaag
gaagcggcatttaagagcatgttaaaacaggccacaccccctctagagcccgaggccacg
tgggagggagtacgagagcgcttcctaaaagagcctgcttttgaagacatcacgctggag
tccgagaggaagagaatattcaaagacttcatgcatgttctagagcacgagtgtcagcat
catcactccaagacgaaaaaacactccaagaaatccaagaaacaccacaggaaacgttcc
cgatctcgatcaggctcggagtcagaggaagatgagtatcacacgaagaagaagaaacgt
tcaacatctaaatctccatctgagcactcgtcctctggggagtcagagagaagttataag
aaatcgaagaaacacaagaagaagggaaagaaaagacgacacaagtctggttcccctgag
tctgaaggagagagagagcggaaaggaagagagaaggacaaagataaagagaacgacaaa
tccagagccaagctgcgtggagaatccaaacagaaatcccccaaaagaaagagtgctaaa
gaagagggtggatgggatacgtctggcagtgaactgagtgaaggagagctggagaagagg
cggcgcacacttctagagcagctggatgctccgtaa

DBGET integrated database retrieval system