KEGG   Danio rerio (zebrafish): 335925
Entry
335925            CDS       T01004                                 
Symbol
septin5a
Name
(RefSeq) septin 5a
  KO
K04557  septin 5
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    335925 (septin5a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dre04812]
    335925 (septin5a)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    335925 (septin5a)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     335925 (septin5a)
SSDB
Motif
Pfam: Septin RsgA_GTPase MMR_HSR1 GTP_EFTU VapE-like_dom AIG1 Ras ABC_tran Dynamin_N AAA_16 AAA_22 Roc AAA_29 nSTAND1
Other DBs
NCBI-GeneID: 335925
NCBI-ProteinID: NP_956282
ZFIN: ZDB-GENE-030131-7868
Ensembl: ENSDARG00000013843
UniProt: Q6PBW0
Position
8:complement(4588886..4618586)
AA seq 369 aa
MTTNIRYKSRSMKSEDSEDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVN
SLFLTDLYKDRKLLNAEERINQTVEITKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECW
RPITDYIDQQFEQYFRDESGLNRKNILDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKV
NIIPLISKADCLTPTEVKKLKDRVRDEIERFGIKVYQFPECDSDEEEEFKQMDKELKECT
PFAVIGSNTVVEARGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDV
HYENYRAHCIQEMTSKLAQDNRTDSPLPILPLPTPDVETEKLIKMKDEELKRMQEMLEKM
QQQMHEKDQ
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgacgaccaacatccgatacaagagcaggtcgatgaaatccgaggacagtgaggacaag
cagtatgtcggctttgccacgcttcctaaccaggtccacagaaagtcagtgaagaagggc
tttgacttcactctgatggtggcaggggaatctggactgggcaagtctacactagtcaac
agtctgtttctcacagacctctataaagacagaaaactgctcaatgcagaagagcgcatt
aatcagacggttgagatcaccaaacacacagtggacatcgaggagaaaggagtgaagctc
aaactcactattgtggacacgccggggtttggagacgctgtcaataataatgaatgttgg
aggcccatcacagactacattgaccagcagtttgagcagtacttcagagatgagagcgga
ctgaacagaaagaacattttggacaacagagttcactgctgtttgtacttcatcccacca
tttggacacggtttgcggccggtggatgtggagttcatgaaggctttacatgagaaagtc
aacatcattcctctgatctccaaagcagactgtctgacccccactgaggtcaaaaagctc
aaggacagggtacgagacgagattgagcgtttcgggattaaagtctatcagtttcctgag
tgtgactctgatgaagaagaggagttcaaacagatggacaaagagctgaaggagtgtact
ccgtttgctgtcataggcagtaatacagtggtggaggccagaggtcaaagggttagaggt
cgtctttacccctggggtattgtggaagtggagaatcagtctcactgtgactttgtgaag
ctgaggaacatgttgattcgctctcatatgcacgacctgaaagatgtgacatgtgacgta
cattatgaaaactacagagctcactgcatccaggagatgaccagtaaacttgcacaggat
aaccgcacagacagtccattacccatcctgcctctgccaacaccagatgtagagacagag
aaactcatcaagatgaaggatgaagagctgaagagaatgcaggagatgctggaaaagatg
caacaacagatgcacgagaaagaccagtga

DBGET integrated database retrieval system