KEGG   Danio rerio (zebrafish): 406514
Entry
406514            CDS       T01004                                 
Symbol
atf4a
Name
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04137  Mitophagy - animal
dre04141  Protein processing in endoplasmic reticulum
dre04210  Apoptosis
dre04261  Adrenergic signaling in cardiomyocytes
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    406514 (atf4a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    406514 (atf4a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    406514 (atf4a)
  09143 Cell growth and death
   04210 Apoptosis
    406514 (atf4a)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    406514 (atf4a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    406514 (atf4a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    406514 (atf4a)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    406514 (atf4a)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB MCU AAA_13 RasGAP_C WDCP
Other DBs
NCBI-GeneID: 406514
NCBI-ProteinID: NP_998398
ZFIN: ZDB-GENE-040426-2340
Ensembl: ENSDARG00000111939
UniProt: Q6NW59
Position
6:269062..272554
AA seq 339 aa
MSLCVGDAGALLLGPWPLTADPQGPLLDQDEESSVLEGSWSPSSSSLSSFSPPASGDAPS
ELLSLSWQPSDVLLTEQSTAGDVFPGMDWMTEKLDLNDFDLDSLIGSCDSEDSPGSPEDL
LACLDSSMDLDLDSLPFGSADLDLPLGLDLPLPEEIKSEPLSPAPSVPSPPEEAPQDEHT
EVPVLHPAGIMLSLSPSHIVVLLTPKEEQNISDCSDSDSGISVSGSPAHQSDLEPSSRAK
PYSRPDPEASPALKGRVKTSSGAPKVEKKLKKMEQNKTAATRYRQKKRVEQESLNSECSE
LEKKNRELSEKADSLSREIQYLRDLLEEMRTAKQRKSKR
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtctctgtgtgttggggacgctggagccctgctgctggggccctggcctctgacggct
gacccccaagggcccctgctggaccaggatgaggagagctccgtgttggagggctcgtgg
tctccctcttcctcttctttatcctctttctctcctcctgcttctggagatgctccgtct
gagctgctgtcgctctcctggcagccgtcagatgtcctgctgacagagcagagcacagca
ggcgatgtgtttcctgggatggattggatgacagagaaattagacctgaatgacttcgac
ctggactctctgattgggtcgtgtgactctgaggattcacccggttccccagaggatctg
ctggcctgtctggactccagcatggatctggatctggactctctcccgttcggttccgca
gacctggatctccctctgggcctggacctcccgcttcctgaagagatcaaatcggagcct
ctctctccagcaccgagcgtcccgtctcctcctgaagaagctcctcaagatgagcacact
gaggttccagttctccatcctgcaggtatcatgctgagcctctctccgtctcacattgtg
gttctgctgactccaaaagaagagcagaacattagcgattgctccgatagcgacagcggg
atctcagtctcaggatctccagctcatcaatcagatctagaaccctcatccagagctaaa
ccatactccagacccgatcctgaagcatccccggcgctcaaaggccgagtgaagaccagc
tccggagctccgaaagtagagaagaagctgaagaagatggagcagaataaaaccgcagcg
acacgctaccggcagaagaagcgtgtggagcaggagtcgctgaacagcgagtgctcggag
ctggagaagaagaaccgtgagctctcagagaaagcagattccctgagccgggagatccag
tacctgcgggaccttctggaggagatgcggaccgccaaacagcgcaagagcaaacgctag

DBGET integrated database retrieval system