KEGG   Danio rerio (zebrafish): 415104
Entry
415104            CDS       T01004                                 
Symbol
ctcf
Name
(RefSeq) transcriptional repressor CTCF
  KO
K23195  transcriptional repressor CTCF
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    415104 (ctcf)
   03036 Chromosome and associated proteins [BR:dre03036]
    415104 (ctcf)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    415104 (ctcf)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    415104 (ctcf)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz Roughex zf-met zf-C2HE zf-C2H2_6 zf-WIZ
Other DBs
NCBI-GeneID: 415104
NCBI-ProteinID: NP_001001844
ZFIN: ZDB-GENE-040624-5
Ensembl: ENSDARG00000056621
UniProt: Q6JAA4
Position
18:22286011..22293372
AA seq 798 aa
MEGGPTEAVVEDAGDAFKAKECKTYQRRREDEEVGAELLQAAVIEQAQAEVEPVVEAQQQ
LVESVVSVNSSVDMMMMETLDPALLQMKTEVMEAAVGAPVAVAGAAHEATVTTVDDTQII
TLQVVNMEEQQLGLGELQLVQVPVSAVPVTAATVEELQGTLVDATAMPKDGEPVICHTLP
LPEGFQVVKVGANGEVETVEQDELQPQDDQPPHQEEEEEMAEPQNEDPAWSKDPDYTPPV
KKVKKTKKSKLRYNTEGDKDMDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPTKIKKK
GVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCGRAFRTVTLLRNHLNTHTGTR
PHKCTDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQ
CSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCP
HCDTVIARKSDLGVHLRKQHSYIEQGRKCRYCDAVFHERYALIQHQKSHKNEKRFKCDQC
DYACRQERHMVMHKRTHTGEKPYACSQCEKTFRQKQLLDMHFRRYHDPNFVPTSFVCTKC
GKTFTRRNTMARHAENCTGMDSADGENGTPPKRGRGGRKRKMRSRKDDDDDDDSDEHGEP
DLDDIDEEDEDDLLDEDQMGLLDQAPPSVPIPAPAEPPIKRKRGRPPKNAPKVSPTKSIT
KTTTAAAIIQVEDESTGAIENIIVKKEPEGTDAVVAAQPIIEEVEAVEADVETVQLTVPE
AAPNGDLTPEMILSMMDR
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggaagggggaccgactgaggccgtggtggaagatgcaggggatgctttcaaggccaag
gagtgcaagacataccaaaggaggcgggaagatgaggaggtgggagccgagctgctgcag
gctgctgtgattgagcaagcacaggctgaagtagagcctgtggtggaggcccagcaacag
ctggttgagagtgtagttagtgtcaacagcagcgtggacatgatgatgatggaaaccctg
gaccctgccttgctgcagatgaagacagaagtcatggaggctgccgttggggcacctgtc
gctgtggctggtgctgctcatgaagccacagtcactacagtcgatgatacacagatcatc
accctgcaggtggtgaatatggaggagcagcagttgggcttgggagagctgcagctggtg
caggtgcctgtttctgctgtgcctgtcaccgccgccactgtggaagagctgcaggggaca
ctggtggatgcaactgccatgcctaaagatggggagccggtcatctgtcacaccctgcca
ttgcctgagggctttcaggtggtcaaagtgggtgcaaacggagaagtagaaactgtggag
caagatgagctccagccccaagacgatcagcctccgcatcaggaggaggaagaagaaatg
gctgaaccccaaaatgaagaccccgcctggtccaaagatcccgactacacacctcctgtt
aaaaaggtcaagaagacgaagaagagcaagctgcgctacaacacagagggtgataaagac
atggatgtgtctgtgtatgatttcgaggaggagcagcaggagggtctgctttctgaagtc
aatgctgagaaagttgtgggtaacatgaaaccacccaaaccaaccaaaatcaagaagaaa
ggtgttaagaagacattccagtgtgagctgtgcagttacacttgcccacgccggtccaat
ctggaccgccacatgaagagccacacagacgagaggcctcacaagtgccatctttgcgga
cgagcatttaggactgtgactttgctgaggaaccatcttaatacccacacaggcaccaga
ccacataagtgcactgactgtgacatggcctttgtcaccagtggagagctggtgcgacac
agacgctacaagcacactcatgagaaaccgttcaagtgctctatgtgtgactacgccagt
gtagaggttagcaagctgaagcgccacattcgctcccacacaggagagcgtccgttccag
tgcagtctgtgcagttatgccagcagagatacatacaagctgaagagacacatgaggacc
cactcaggagagaagccctatgagtgctatatctgtcatgcacggtttacccagagtggc
accatgaagatgcacattctgcagaagcacacagaaaatgtggcgaaatttcactgccct
cactgcgacaccgtcattgcccgcaagagtgatcttggtgtgcatctccgtaagcagcat
tcctacattgaacagggcagaaagtgccgttactgtgatgctgtgttccacgagcgctac
gctcttatccagcatcagaaatcccacaaaaatgagaaacgcttcaagtgtgatcagtgt
gactatgcatgccgccaggagcgtcacatggtcatgcacaagcgcacacatactggggag
aagccatatgcctgcagccaatgtgagaagacctttaggcagaaacagctgttggacatg
cactttcgccgctatcatgaccccaactttgtacccacatcctttgtatgcaccaagtgc
ggaaagaccttcactcgcaggaataccatggcaagacatgcagagaactgcactggtatg
gattctgctgatggagagaacggaactccacccaaaaggggccgtggaggcagaaagagg
aagatgcggtctagaaaggatgatgacgatgatgatgacagtgatgagcatggtgaacct
gaccttgatgacattgatgaagaggatgaggatgaccttcttgatgaagaccagatgggt
ttgctagaccaggctccacccagtgttccaatccccgcaccagctgagccaccaatcaag
aggaaacggggcagaccccctaagaacgcacccaaggtctctcctaccaagtccattacc
aaaaccaccacagctgctgccattatccaggtggaggatgaaagcacaggggccattgag
aacatcattgtgaagaaggagccagagggcactgacgcagttgtagctgcccagccgatc
atagaggaagtggaggcggttgaggccgatgtagaaacggtgcagttaacagtcccagaa
gctgcacctaacggtgatcttactcctgaaatgatccttagcatgatggaccggtga

DBGET integrated database retrieval system