KEGG   Danio rerio (zebrafish): 560145Help
Entry
560145            CDS       T01004                                 

Gene name
col27a1b
Definition
(RefSeq) collagen alpha-1(XXVII) chain B precursor
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    560145 (col27a1b)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   560145 (col27a1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI Laminin_G_2 GH131_N Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 560145
NCBI-ProteinID: NP_001074044
ZFIN: ZDB-GENE-100119-2
UniProt: A0MSJ1
Position
5
AA seq 1658 aa AA seqDB search
MEPDNTPSSRLRAAGVGGRAVFFCMVLYCTCCLRLAQAQSADVDVLQRLGLVGKRPPQGF
IPIKSGVILTTRARIDVPVSSVIPVSLGSTFSIILSVCSHRINNAFLFTIVTKRKRLHLG
VQFIPGQILVYLGQNSSVNFDYNVHNGQWHNLALEIQGQKVTLYTSCGNTSIQANLDFQN
EETLDSEGSFRLGKMSQNSVQFEGAICQFDIHPSAQAAHNYCKYIKKQCREADTYRPNLP
PLLPLLPLDPNRSTIQTPKVVTDINERHLSLTRDKMNINHEGQTTVPPMITQPTLQLPLQ
TTAQTTASIRNRTSQISPKPTQQNRKKAKKERNKLHILKEHQISVTDSPTSQQQNQVDIP
TTTTPELSSTFRVSEMTTLAAQRPLPKETSFFEAKATFFESVTPAAMDGLQTFDLEPTQY
SLLELTGLKGEPGLPGPPGPPGQPGLPGKRGPRGPSGPHGKPGPPGTPGPKGKKGNPGIS
PGRAPSGIKGDPGLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRGPDGSPGAKGYPGRQ
GLPGPIGNMGPKGVRGFIGIPGIFGLPGADGERGLPGVPGKKGKMGRPGFPGDFGERGPP
GPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLP
GEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQN
GVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEP
GMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLS
GPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKI
GETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLP
GEPGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAGPSGPDGAKGEQGDVGLEGESGEKGVI
GFKGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFI
GPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGP
PGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGN
KGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGR
DGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGKQGD
QGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGIQGPKGPQGLMGMQGAIGPVGIIGP
SGNPGPQGDKGNKGEMGVQGPRGPPGPRGPPGPPGLPAVAFSHENEALGAALHVFDSRSA
LRSEMYQDTDLPLLDQGSEIFKTLHYLSILIHSIKNPLGTQENPARMCRDLLECEHRLND
GTYWIDPNLGCSSDNIEVTCSFTSGGQTCLKPVTASKLEIGVSLIQMNFIHLLSSEAVQI
ITVHCLNVSVWASEDSKTPSSSMVYFKAWDGQIIEAGGFIEPDLLKDECWITDGRWHQTQ
FIFRTQDPNLLPIVEIYNLPSTKPGSHYHLEVGPVCFL
NT seq 4977 nt NT seq  +upstreamnt  +downstreamnt
atggagccggacaataccccgagctccagactcagagcagctggggtcggggggagagca
gtgtttttctgcatggttctttactgtacatgctgtttgaggctcgcacaagcacaatct
gcagatgtggacgtgctgcaaagactgggattggttgggaaaagaccacctcaaggcttc
atccctattaaatcaggagtcatcctaaccacaagggcaagaattgacgtcccggtgagc
tccgtcattcctgtgtcactgggctcgacgttctctatcatcctcagcgtatgttcccat
cgcataaacaatgctttccttttcaccattgtgacaaagaggaaaagactgcacctaggg
gtgcagttcatccctggacagatattagtctacctaggccaaaacagctctgtaaatttt
gattacaatgttcacaatggccagtggcacaacctggctttggaaatccaaggccaaaag
gttactttatatacttcctgtgggaatacaagcatacaggcaaatctggattttcaaaat
gaggaaacgctggattcagagggctcctttcgcttgggaaaaatgagccagaactcagtg
cagttcgaaggagccatctgccagtttgacattcatccctctgctcaggcagctcacaat
tattgcaagtacattaaaaaacaatgcagggaggcggatacttatcggccaaaccttcct
cctcttctaccactattacccctggaccctaatagatctaccattcaaactcccaaagtt
gtaacagatatcaacgaaagacatctttcactaacacgagataagatgaatattaatcat
gaaggccaaaccacggtgccaccaatgataacccagcccacactacagctccccctgcag
accacagcgcaaactactgcctccattaggaacaggacttcacaaatatctccgaagcca
actcaacaaaacaggaagaaagcaaaaaaagaacgtaacaagttacatattttaaaagag
caccagatttctgtcactgacagtccaacaagtcaacaacaaaaccaagtagatattcca
accacaacaacacctgaactttctagtacattcagggtgtcagaaatgacgacattagca
gcacagagacctctgccaaaggaaacctccttttttgaagccaaagccaccttttttgag
tctgtaacccctgcagctatggatggtttgcaaacttttgacttggaaccgacccagtat
tccctcttggagttaactggactgaaaggagaacccggactaccgggaccaccaggacct
ccgggccagccaggattaccgggaaagagaggtccccggggtccctctggtccgcatgga
aaaccaggacccccagggactcctggacctaagggaaaaaagggaaatcctggaatctca
cctggcagagcaccaagtggaataaagggcgaccctggattagtaggtctgcctggacaa
cccggtcaacccggtcgtaaaggacagaaaggccatcctggtccctctggccaccctgga
gaccaaggaataagaggaccggatggaagtccaggtgccaaaggttatcctggcaggcag
ggcttacctgggcctataggaaatatgggaccaaaaggcgtacggggcttcattggaatc
ccaggcatcttcggtctccctggagctgacggagaaagaggtttacccggtgttcctggg
aagaagggcaagatgggtaggccgggctttccaggagattttggggagcgaggaccacca
ggacctgatggaaacccaggggaaatcggcgccccggggcctgttggcatccctggattt
attggtgatatgggccctgttggaatggtcggtcctcctggactaataggaccaaagggt
gtcccaggaaacccaggagagcccggactgaaaggtgataagggtgagctcggattgcca
ggtgaacccggggaacctggatttcaaggtgacaagggtattcagggctcaccgggttta
ccaggagttcaaggaaagccaggaccacaggggaagattggagatcgaggtccagacggt
ttgcccggcccacttggtcctgagggttttccaggggatattggaccaccaggacagaat
ggtgttgagggcccaaaggggaatgcaggagtgagaggcattccaggccctggaggactc
cctggactcgagggagatcagggaccagtgggaccagcaggggctccaggactagagggc
agacctgggaggaaaggtatctctggcaatccaggggaggaagggatgaagggagagcct
ggaatgactggaaatcctgggatgcttggtgagaggggtcctgttggtttcgtcgggcct
tttggtgagatgggacttgctggagaaaagggagatcgtggtgagacgggtcagcctggg
ccacctggagaaaagggagccatgggtcacccaggggctccaggagagagaggcctgtct
ggaccagcaggtgctccagggcctcatggatctaggggcctcagtggcaccagggggcca
aaaggcacaaggggtgcaaggggaccagatggaccagttggagagaaaggaatgatggga
atgaagggtcctgaaggtccaccaggaaaacaaggtttaagcggacaaatgggtaaaatt
ggagaaactggtgaagcaggacctaccggatttactggtgttcaaggaccaactggacct
cctggagcaaaaggcatcttaggagaacctggtcctcaaggatcaccgggagtgttgggt
ccattgggtgagattggagcaataggtttacctgggaaggctggcgatcagggcttaccg
ggagaaccaggagagaagggtgcagtcgggtctcctgggaatattggagagcaaggcctg
attggacctcgaggtgaccctggagtcgatggagaggctggtccaagtggtcccgatgga
gccaagggtgaacagggggatgttggactggagggagaatcaggcgaaaaaggagtcatc
ggatttaaaggaacagagggacgtactggtgatcctggcttaataggcgtcaagggccct
gaaggcaaaccagggaaaattggtgagaggggaaaacctggagagaagggcagcaaaggt
catcaaggtcaacttggcgagatgggtgctttgggtgagcaaggtgacacgggtttcatc
gggccaaaaggaagcagaggaactactggatttatgggtgctccgggaaaaatgggtcag
cagggagagccaggtttggtgggatatgaaggtcatcaagggccacaaggttcattggga
tccccgggaccaaaaggtgaaaagggagagcaaggcgatgacgggaaggttgaaggtcca
cctggtccttctggtgacatcggacctgttggcaacagaggagacagaggagaacctggt
gaccctggatacccaggccttgaaggtgttcaaggagaaagaggaaaagagggggctcct
ggagtccctgggaattcagggcctagaggttttccagggcccaaaggatctaaaggcaat
aaaggtccaaaaggcaaaaacagtcctcgtggtgaatctggaaaccgagggtctcctggt
cctgttggtgttcctgggcccagaggggtcattggtagagagggttttgagggggaacct
ggactggatggagctgctgggaaagatggagctaaaggaatgccaggtgatcttggacgt
gatggggatgttgggctgcctggaaaaccgggtcctcaaggaaatgcaggagcaccaggt
ctaccaggagttcaaggctcttttgggccaaagggggaaaggggcatcactggtcattct
ggacctccaggcaaaagaggactgaacggaggaatgggatttcctggaaaacaaggcgac
caaggcttcaaaggacaacctggtgatgctggtgaacagggatttcctggagttcttgga
atatttggaccacaggggcctcctggagacttcggtccagtgggtatacagggtccaaag
ggtcctcagggtttaatggggatgcaaggagccatcggaccagttgggatcattgggccg
agtggaaacccaggaccacaaggagacaaaggaaacaaaggggaaatgggtgttcaggga
cccagggggcctccaggtcctcgtggaccaccgggacctccagggcttcctgctgtagcc
ttctctcatgaaaatgaggcccttggtgctgctttacatgtttttgattcccgctccgca
ttaagatctgaaatgtatcaggatactgaccttccactgctggatcaaggaagcgagatt
tttaagactcttcactacctcagcatcctgatccacagtatcaaaaacccgctgggaacg
caggagaatccggccagaatgtgcagggatctgcttgaatgcgagcaccggttgaatgat
ggcacttattggatagatcctaacctgggctgctcctctgacaacattgaagtgacctgt
agcttcaccagtggaggtcaaacctgccttaagccagtcactgcttccaagctggagatc
ggagtcagtctgatccagatgaacttcatccacctcctgagctctgaggctgtgcagatc
atcaccgttcactgtctgaacgtctccgtttgggcatcggaagactccaaaacaccttcc
tccagcatggtatactttaaagcctgggatggacagataatcgaggctggaggattcatc
gagcctgatttgctgaaggatgagtgctggatcacagatggtagatggcatcaaacacag
ttcattttccggacgcaggacccaaacttactacccattgtggagatctacaacttgccc
agcactaaacctggctcacattaccacctggaggtgggccctgtgtgctttttataa

DBGET integrated database retrieval system