KEGG   Maridesulfovibrio salexigens: Desal_1706
Entry
Desal_1706        CDS       T00969                                 
Name
(GenBank) CagE TrbE VirB component of type IV transporter system
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
dsa  Maridesulfovibrio salexigens
Pathway
dsa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dsa00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Desal_1706
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dsa02044]
    Desal_1706
Enzymes [BR:dsa01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Desal_1706
Secretion system [BR:dsa02044]
 Type IV secretion system
  Trb secretion system protein
   Desal_1706
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 ABC_tran DUF87 AAA_22 AAA_29 AAA_23 AAA_21 AAA_16 Zeta_toxin
Other DBs
NCBI-ProteinID: ACS79768
UniProt: C6BT64
Position
complement(1870634..1873084)
AA seq 816 aa
MLKLKDYRHKQKSLPDLLSYAAMVDNGIVLCKNGALLAGWIFRSQDTASSTPQELATISA
RVNQALAPLGSGWMCHVEAIRTPATGYPAPATSFFPDRITAMIDEERRNIFESGEFYTTS
TFLAVTCTPQLGQEKIKRYATGQTGRNNQLDKQINEFKKTLFQLEDSLSLCLQLERLADY
TYEDEFGNSKTVSPLLTFLQICTTGENHPVILPSTPMYLDAIIGCKDLIAGDSLFIGKNQ
IQIIAIDGFPAESWPSILSCLEGTPLEYRFSSRFICMDQFEAEKELTLYRKTWQQQVFKF
FDLMFNKANPRPNQDALNMAGDAETALAEVQSGLVSAGFYTACIVLHGTDPEKLEDNTRL
ISRLIQGQGFGCRIETINALEAWLGTHPGNAYANVRRPIVNSMNLSDMLPLATIWPGNEF
NPSPEFPANSPALMYCATDGSTPFRLNLHTGDIGHTLIFGPTGAGKSTLLGIINAQFRRY
KNASIFAFDKGMSMFPLCKAAGGTHYEIAGDDSELAFAPLSNVDSDAEQAWAEEWIETLV
TLQGFVVLPAHRNAIHLAMNSIRNNPKDMRSLTDFYHFVQDEELREAIKHYTNAGAMGHL
LDAKTDGFGIENLMVFEIENLMNLGDKNLIPVLLYLFHCIEKSFKGQPSLLILDEAWIML
GHKVFRDKIYEWLKVLRKANCAVVLATQSLEDAAKSGLMGVLSESCPTKIYLANPSASDK
DQRPHYEGLGLNSTQIQIITSAAPKRDYYVVTPEGRRLINLALGPVALSFVGSSGKGHIA
RIKELEKEHGPSWPEQWLEERQGDFKWAPRSKENTK
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgctcaagctcaaagactaccgccataaacagaaaagcctgccggacctgctttcatat
gccgccatggtggataatggaattgtcctttgtaaaaacggcgcgcttctagccggctgg
atattcagatcccaagacacagcatcaagcacacctcaagaactggcgacaataagcgca
cgagtcaaccaagctcttgcgcctcttggatctggctggatgtgtcatgtcgaggccatc
cgaactcctgcgaccggctaccctgctccggcgacaagtttctttccggatagaatcacg
gcgatgattgatgaggagcgcaggaacatttttgaatcaggggaattctatacaaccagc
acttttctggctgtgacttgtacaccacagttaggacaagaaaaaatcaaaagatatgca
actgggcagacaggtaggaacaaccagctcgacaaacagatcaacgaattcaaaaaaaca
ctatttcagcttgaagactctctttctctctgccttcagcttgagcgactggccgactat
acatatgaagatgagttcggaaacagcaagacagtctcaccgctgctaacattcttgcag
atatgtaccaccggagaaaatcacccggtaattctgccctctacccccatgtatctggat
gcaattatcggctgcaaagatttgattgccggcgattcacttttcatcggaaagaaccag
atccagatcatcgccatagatggatttccagccgaaagctggccctcaatcttatcctgc
cttgaaggaacccctttagaatacagattttcaagccgcttcatctgtatggatcagttt
gaagccgaaaaagaactcaccttgtatcgtaagacatggcaacagcaggtatttaaattt
ttcgacctgatgttcaacaaggccaatccaagaccgaatcaggatgctctcaacatggca
ggagatgcggaaacagctcttgctgaagttcagtccggcctagtttctgccggcttctat
acagcatgcattgtgttgcatggaacagatcccgaaaagctggaagataataccaggctc
atcagccggctaattcaaggtcaaggattcggatgccgcattgaaacaatcaatgctctt
gaggcatggctgggaactcatcccggtaacgcatacgcaaacgtccgtaggccgatcgtt
aattcaatgaacctttcggacatgcttccattggcgacaatctggcccggtaatgaattt
aacccttcaccggaatttccagccaattcaccggctcttatgtattgcgcaactgatggt
tcaacaccgttcaggctgaacctgcacacaggcgatatcggacacaccttgattttcggc
cctaccggggccggtaaatctacactgctcggcattattaacgcccagttcagaagatat
aagaatgcatccatttttgccttcgacaaaggcatgtccatgtttccgctctgcaaagct
gccgggggaactcattacgaaatagccggtgatgattcagagctagcctttgcccctctt
tcgaacgttgattctgatgccgagcaagcctgggcagaagaatggattgagactcttgtg
actctgcaaggattcgttgtcctacctgcgcaccgcaatgcaattcatctggcaatgaat
tcaatccggaacaacccgaaagacatgcgctctcttactgatttttaccactttgtgcag
gatgaagaactcagggaagccataaaacattacaccaatgccggggctatgggacatctg
ctcgatgcaaaaacggatggatttggcattgaaaatctaatggtcttcgagattgaaaac
ttgatgaacctaggagacaagaacctcattcctgtccttctttatcttttccactgcata
gaaaaatcctttaaaggacagccctctctgctcattctggatgaagcatggatcatgctt
ggtcataaagttttccgggataagatttatgaatggctgaaggttctgcgtaaagcaaac
tgcgcagttgttctggctacgcagtctttagaagatgcggctaaatcggggctcatgggc
gttttgtctgaatcctgcccgaccaaaatttacctagcaaaccccagcgcgtccgacaaa
gaccagcgaccgcactatgaaggtcttggcctcaactccacccagatccagatcatcacc
tccgcagctccaaagcgcgattactacgttgttactcctgaaggacgcaggctcataaac
ttagctctcggtcctgtcgcgctctcttttgtcggttcatccggcaaaggacacatcgcc
cgtatcaaggaacttgaaaaagaacatggcccaagctggccggaacaatggcttgaagaa
aggcagggagatttcaaatgggcacccagaagcaaggaaaacacaaaatga

DBGET integrated database retrieval system