KEGG   Dinoroseobacter shibae: Dshi_3640Help
Entry
Dshi_3640         CDS       T00612                                 

Gene name
virB2
Definition
(GenBank) type IV secretory pathway VirB3 family protein
  KO
K03198  type IV secretion system protein VirB3
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dshi_3640 (virB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dsh02044]
    Dshi_3640 (virB2)
Secretion system [BR:dsh02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Dshi_3640 (virB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB3 DUF1420
Motif
Other DBs
NCBI-ProteinID: ABV95373
RoseoBase: Dshi_3640
UniProt: A8LT06
Position
pDSHI01:40080..40358
Genome map
AA seq 92 aa AA seqDB search
MAERSPLFLGLVRPPKLLGLPIMYAMVWLFGSVLLFVWVQHIAVLGVAALLYPVLWKAAD
WDPRFIDVMMTALQETPPTRNRSIHGGDSYAP
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagcgctcgcctctttttctcggcctcgtgcgtccgcccaagcttctgggcctg
ccgatcatgtatgcgatggtctggctcttcggttcggtgctcttgttcgtctgggtccag
cacatcgcggtgctgggtgtcgccgccctgctctatccggtgctgtggaaggccgcggat
tgggacccgcgtttcatcgacgtgatgatgacagcgctgcaggagacgccacccacgcga
aaccgcagcatccatggcggggacagctatgccccgtga

DBGET integrated database retrieval system