KEGG   Drosophila simulans: Dsimw501_GD15757Help
Entry
Dsimw501_GD15757  CDS       T01065                                 

Gene name
Dsim_GD15757
Definition
(RefSeq) uncharacterized protein
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsi04131]
    Dsimw501_GD15757 (Dsim_GD15757)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsi04147]
    Dsimw501_GD15757 (Dsim_GD15757)
Membrane trafficking [BR:dsi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Dsimw501_GD15757 (Dsim_GD15757)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsimw501_GD15757 (Dsim_GD15757)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6 HyaE B12D
Motif
Other DBs
NCBI-GeneID: 6726119
NCBI-ProteinID: XP_016039610
FlyBase: FBgn0187418
Position
X
AA seq 412 aa AA seqDB search
MFGARIGIGKLGPCVALVAILQLLQHTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAE
WCRFSNILAPIFAEAADKIKEEFPEAGKVVLGKVDCDKETAIASRFHINKYPTLKIVRNG
QLSKREYRGQRSAEAFLEFVKKQLEDPIQEFKSLKDLENLDSKKRLILGYFDRRDQPEYD
IFRKVATNLKEDCQFHVGFGDAAQAMHPPGTPIIVFRPDVALSHENDETYTGSLQNFDEL
KIWVQEKCVPLVREITFENAEELTEEGLPFLILFHHPTDHNSIKDYKSIIERQLLDEKQN
VNFLTADGKRFAHPLHHLGKSEDDLPLIAIDSFKHMYLFPHFSDMYSPGKLKQFLQDLYS
GKLHREFHYGPDPSNDIEPDPHTGKGTSPPESKFKELGPSKHRYTLLEKDEL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtttggagccagaatcggaatcggaaagcttgggccgtgtgtggccctagttgcgatt
ctacagctactccagcacacacagccggcagatgccgccggagccgtgcccatgaccagt
gataatatcgatatgaccctagcgtctaatgaattggttttccttaatttttatgcggag
tggtgtcggtttagtaatattttagcacctatattcgcggaagctgcagataagattaag
gaggagtttccagaggctggaaaggtggtgctaggcaaggtcgattgcgacaaggagacg
gccatcgcgtcccgtttccacataaacaagtatccaaccttgaaaattgtccgcaatggg
cagctcagcaagcgcgaataccgaggacagcgttcggccgaagcgttcctcgagttcgtc
aagaagcagctggaggatcccattcaggagttcaaatccctgaaggatctggagaacctg
gactcgaagaagcgcctcattctgggctacttcgatcgtagggaccagccagagtacgac
atattccgcaaggtggcgacaaatctgaaagaggactgccagttccacgtgggcttcgga
gatgccgcccaggccatgcatccaccaggaacacctatcatagtatttagacccgatgta
gctctgtctcatgagaacgatgagacctacactggcagcctacaaaatttcgatgagctc
aaaatttgggtccaggagaagtgtgtgcccctggtgcgtgaaatcacctttgagaatgca
gaggaacttacggaggagggtctgccgttcctaattctcttccaccatccaactgatcat
aactccatcaaggattacaagtcgatcattgagcgccaattgctggatgagaaacagaac
gtcaactttttgaccgccgatggcaagcgattcgcgcatcctctgcaccatctgggtaaa
tccgaggatgacttgcccctgattgccatcgactcgttcaagcacatgtatctgttcccc
cacttcagcgacatgtactcgccgggcaagctgaagcagttcctccaggatctctacagt
ggcaagctgcacagggaatttcattacgggccggatccctcaaatgatattgaacctgat
ccacacactggcaagggtacatcgccgccagagtccaaattcaaggaacttggcccatcc
aagcatcgctacaccctgctagaaaaagatgaactgtaa

DBGET integrated database retrieval system