KEGG   Ensifer adhaerens Casida A: FA04_29670
Entry
FA04_29670        CDS       T04507                                 

Definition
(GenBank) dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00230  Purine metabolism
eah01100  Metabolic pathways
eah01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    FA04_29670
Enzymes [BR:eah01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     FA04_29670
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C Peptidase_M24
Other DBs
NCBI-ProteinID: ANK76866
Position
pCasidaAB:437763..440069
AA seq 768 aa
MNMTTPIEQREFKIVGKSVKRDDVLEKVTGEAQYTGDIKLPGMLHGKIKRAAIAHARIKS
IDVSKALAYPGVKAVLTHETVPRVLHYGSPHPRSASCTKDQYILDDKVRFWGEGVAAVAA
ISEEIADEALDLIEVEYEPLPAVFEPEDAAQPGAPLIHDVGPGGNLVLDPVRVNRGDIDK
GFAEADFVLEGTFAGGRPHPAYMEPNVCIADWDGSNKLTFWTSTQTSFMVRGILAEVLGL
PLTKVRVLVDHMGGGFGAKQDLFQHEFLCALLAKETRRPVKMEFTRHETFVAGRSRHPCR
IWLKQGFKNDGTLVARDMKLVYDSGAYGSHGPGVTIVGTTAATSLYRCENVRLEGRCVYT
NTPINGAFRGYGVVQSYYALDIQMDEAAERLGMDPAELKLKNVVGAGDIAPSGHPILGHG
LEICLKHGIDVLDWKALWNRDRAPDPKRPHIRKGWGIGCEMHGSSAYPGIKEQGNATVKV
NEDGTVTLLTGAAGLGTGAHTALAQIVAEELGVRFEDVGVIHGDTDVVPWDIGAFASHTT
YLVGTAAKMAAGKVRAAVLARAAMKLQVSPDEIDLSEGKVFLIAEPDRSMTVSEAMGPSR
GIPAANIVANGTYEPTKSYSFAAHFTEVDVDTETGIVEVKRVVPVHDVGRVIHPIAAQGQ
IEGGIQQGIGHTLTEDYVIDKKTGRSLNAGLVDYKMPLSMDMPDIETIILEAAPDPGGPW
GAKGVGEDPIIAIGPSIANAIHDAIGVRFHHYPITPEDILKALREKGA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgaacatgaccacccccattgaacagcgcgagttcaagatcgtcggcaagagcgtcaag
cgcgacgacgtgctcgaaaaggtcacgggcgaggcgcagtataccggcgatatcaagctg
cccggaatgctgcacggcaagatcaagcgcgcggcgatcgcccatgcgcgcatcaagtcg
atcgacgtcagcaaggcgctcgcctatccgggcgtcaaggctgtgctgacccacgagacc
gtgccacgcgtgctgcactatgggtcgccgcatccacgctcggcctcctgcaccaaggac
cagtacattctcgacgacaaggtgcggttctggggcgagggcgtcgccgccgtcgctgcc
atcagcgaagagatcgccgacgaggcgctcgacctgatcgaggtggaatacgaacctttg
ccggccgtcttcgagccggaggacgccgcgcagccaggcgcaccactgatccacgacgtt
gggccgggcggcaatcttgtgctcgacccggtgcgcgtcaaccgcggcgacatcgataag
ggttttgccgaggcggacttcgttctcgagggcacgtttgccggcgggcggccgcacccg
gcctatatggagccgaacgtctgcatcgccgactgggacggttccaacaagctgaccttc
tggacctcgacccagacctctttcatggtgcgtggcatccttgcagaagtgctcggcctg
ccgctcaccaaggtgcgcgtgctcgtcgaccatatgggtggcggctttggggccaagcag
gacctgttccagcacgagtttctctgtgcgcttttggcgaaggaaacccgccggccggtg
aaaatggagttcacccgccacgagacattcgtggccggtcgttcccgtcacccttgccgg
atctggctgaagcagggcttcaagaacgacggcacgctcgtcgcccgcgacatgaagctg
gtctacgattccggcgcctacgggtcccatggcccgggcgtgaccatcgttggaaccacc
gccgctacctcgctctatcgctgcgagaacgtgcggctggaggggcggtgcgtctacacc
aacaccccgatcaacggcgccttccgcggctacggcgtggtgcagagctactatgcgctc
gacatccagatggatgaagcggccgaacggctcggcatggatccggccgaactgaagctg
aagaacgtggtgggcgccggcgacatcgcgccatccggccatccgatcctcggtcacggg
cttgaaatctgcctcaagcacggcatcgacgtgctcgactggaaggcgctttggaaccgc
gaccgggctccagatccgaagcgcccgcacatccgcaaagggtggggcatcggctgcgag
atgcacggctcgtctgcctatcccggcatcaaggaacagggcaatgccacggtgaaggtc
aacgaggacggaacggtgacgctgctaactggcgctgccggacttggcaccggagcccat
acggcgctggcgcagatcgttgccgaagagctcggggtccgcttcgaggacgtcggcgtc
atccatggcgacacggacgtggttccatgggacatcggggcctttgccagccacacgacc
tacctggtcggcacggccgccaagatggcggccggcaaggtccgcgctgccgtgctcgcc
agggcagcgatgaaacttcaggtctcgcccgacgagatcgacctttccgaaggcaaggtc
ttcctcatcgccgagccagatcgctctatgacggtgtcggaggccatggggccttcacgt
ggcattcctgccgccaatatcgttgccaacggcacttacgagccgacgaaatcctactcc
ttcgccgcacatttcaccgaggtggacgtcgacacggaaacgggcatcgtcgaggtcaag
cgcgtcgtgcctgtgcacgacgttggacgcgtcatccacccgatcgccgcgcaaggccag
atcgagggcggcatccagcagggcatcggccacacgctgaccgaggactacgtcatcgac
aagaagaccgggcgctcactcaatgcgggcctggtcgactacaagatgccgctgtcgatg
gacatgcccgacatcgagacgatcatcctcgaggcagcgcccgacccgggtggtccctgg
ggcgccaagggtgtgggcgaagatccgatcatcgccatcggcccttccatcgccaatgcc
atccacgacgccatcggcgttcgcttccaccactatccgatcacaccggaagacatcctg
aaagccttgagggagaagggcgcatga

DBGET integrated database retrieval system