KEGG   Enterobacter soli: Entas_1925
Entry
Entas_1925        CDS       T01604                                 

Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_1925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1925
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1925
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 AAA_22 AAA_23 ATPase_2 NACHT AAA_25 Sigma54_activat AAA_7 AAA_24 IstB_IS21 Clp_N TniB Zeta_toxin AAA_29 SRP54 AAA_14 NUC173 Peptidase_M78 Hpr_kinase_C
Other DBs
NCBI-ProteinID: AEN64664
Position
2070926..2073580
AA seq 884 aa
MENPAILLRRLNPYCARAMEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEW
DMDTLWQALLGWLDNQPRSVRSRPQLSADIQKLMQEAWMQASLAGEESIRSQHLLMALTE
NPRLAHCDGLWPLLTLGMSQLSRLRPLLDAQSDERPEMQFEAELAQVHGSEVEFVGRPVG
AELKEGELNPALQNALDKFTLDVTAKAKEGKIDPVFGRDTEIRQMVDILSRRRKNNPILV
GEPGVGKTALVEGLALRIAEGNVPESLKPVILRTLDLGLLQAGAGVKGEFEQRLKNVIDA
VQQSPVPILLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQYFER
DAALERRFQMVKVDEPDDDTACLMLRGLKSRYAEHHNVHITDDAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTAAARVRMSLDTVPEQIVRLKAQLTALALEEQALLEDIAAGSNRHGDRLG
AIGQQRTELEARIEEQEARFSHEKALVQQLMASRQDISQQAEISELQQQLEQAQQGDVLV
QADVDTRMVANVIADWTGVPLSSLMKNEQTELLSLENEIGKRVVGQDVSLNAIAQRLRAA
KTGLTSENGPQGVFLLVGPSGVGKTETALALADVLYGGEKSLITINLSEYQEPHTVSQLK
GSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVMNLFYQVFDRGFMRDGEGREI
DFRNTVILMTSNLGSDHLMQLLDEQPEATEGDLHELLRPILRDHFQPALLARFQTVIYRP
LVEAAMRTIVEMKLSQVSKRLHRHYGLTTQIDESLYDALTAACLLPDTGARNVDSLLNQQ
ILPVLSQQLLTHMAARQKPQSLCLSWSEEEGIGLEFDRTQGVHV
NT seq 2655 nt   +upstreamnt  +downstreamnt
atggaaaatccagccatcctgttgcgacgtctgaacccttactgtgctcgtgcgatggaa
ggggcggcttcgctctgccagacccgtgcccatgcggaaattttgccggagcactggctg
ctgaagttgctcgaacagggggaaggtgacctgacggtgctggcacgtcgctacgagtgg
gatatggacacgctgtggcaggcgttgctcggctggctggataatcaaccgcgttcggta
cgcagccgcccgcaactgtccgcagatattcagaaactgatgcaggaagcctggatgcag
gcctcacttgccggagaggaaagtatccgaagccagcacctgctgatggcgctgacggaa
aacccacgacttgctcactgcgacgggctgtggccactgttgacgctcgggatgagtcag
ctttcccgactacgcccgctgctggatgctcagtctgatgaacgcccggagatgcagttt
gaggctgaactggcccaggttcacggcagtgaggtggagtttgttggccgtccggttggt
gcagagctgaaagagggcgaactgaacccggcgctacagaacgcgctggataaattcacc
ctcgatgtcaccgccaaagcgaaagagggcaagattgatcctgtgttcggtcgtgatacc
gaaatccgccagatggtggatattctctcgcgccgtcgtaagaacaacccaatcctggtc
ggtgagccaggcgtcggtaaaaccgcgctggtcgaaggcctggcgctgcgtattgccgag
ggcaatgtgcctgagtccctcaaaccggtcatcctgcgcacccttgatctcggcttgttg
caggctggcgcaggggtgaaaggcgagttcgagcagcgcctcaaaaacgttatcgacgcg
gtgcagcagtcaccggtgccgattctgctgtttatcgacgaagcccacaccattattggt
gcaggtaaccaggcgggcggcgcggatgcggccaacctgctgaaaccagcactcgcccgc
ggcgaactgcgcaccattgccgcgaccacctggagcgagtacaaacagtatttcgagcgc
gatgccgcgctggaacgtcgcttccagatggtgaaggtggacgagccggatgatgacact
gcgtgcctgatgctgcgtggcctcaaatcccgctatgccgaacaccacaacgtacacatc
actgacgatgcggtgcgtgcggccgttacgctgtcccgtcgttacctgacgggacgccag
ctgcctgacaaggccgttgacctgctggataccgcggccgcacgtgtgcgtatgagtctc
gatacggtgccagaacaaattgtgcgcctgaaagcacaactgaccgcactggcactggaa
gagcaggcgttactcgaagatatcgccgctggcagcaaccgccatggtgatcgccttggg
gccattgggcagcagcggactgaactggaagcgcgtatcgaggagcaggaagcgcgtttc
agccacgaaaaggcgctggtacagcagctgatggccagccgacaggacatcagccagcag
gctgagatttccgagctgcagcagcaactcgaacaggcacaacagggcgacgtgctggtt
caggcggatgtggacacccgtatggtcgcgaatgttatcgccgactggaccggcgtgccg
ctgtcttcgctgatgaaaaacgaacagaccgaactgctgagcctggaaaacgaaattggc
aaacgtgtggtcgggcaggatgtttcccttaacgctattgcgcagcgtcttcgcgcggcg
aaaaccggcctcacttccgaaaacgggccgcagggcgtgttcctgcttgtcggtccgagt
ggtgtaggtaagaccgaaaccgcgctggcgctggcggacgtgctgtacggcggtgaaaaa
tcgctgattaccattaacctgtccgagtaccaggagccgcacaccgtgtcgcagctgaaa
ggctcgcctccgggctatgtcggttacggccagggcggcattctcaccgaggccgtgcgc
aagcgcccgtacagcgtggtgctgctcgatgaagtggaaaaggcgcaccgtgacgtaatg
aacctgttctaccaggttttcgaccgcggctttatgcgcgacggcgaagggcgcgaaatc
gactttcgcaacaccgttatcctgatgacctccaacctcggcagcgaccacctgatgcag
ctgctggacgaacagccggaggctaccgaaggcgatctgcacgaactgctgcgcccgatt
ttacgcgaccacttccagccggcactgctggctcgtttccagaccgtgatttaccgcccg
ctggtggaagcggctatgcgcactattgtcgaaatgaagctgtcacaggtcagcaaacgc
ctgcaccgtcactacggcctgaccacgcagatagatgaaagcctgtatgacgcgctaacc
gccgcctgcctgctgccggataccggcgcacgcaacgttgacagtctgcttaatcaacaa
attctgccggtgctgagccagcagctgctgacccatatggccgccagacagaaaccacag
tcgctttgccttagctggagtgaggaagagggtatcgggctggagtttgaccgtacacaa
ggagtgcacgtatga

DBGET integrated database retrieval system