KEGG   Erwinia amylovora ATCC 49946: EAM_1770
Entry
EAM_1770          CDS       T01199                                 

Name
(GenBank) putative esterase
  KO
K03929  para-nitrobenzyl esterase [EC:3.1.1.-]
Organism
eay  Erwinia amylovora ATCC 49946
Brite
KEGG Orthology (KO) [BR:eay00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EAM_1770
Enzymes [BR:eay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     EAM_1770
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 Say1_Mug180
Other DBs
NCBI-ProteinID: CBJ46445
Position
complement(1915845..1917371)
AA seq 508 aa
MRNDQRLRIVTAEGILRGNEAEGVFVFKGIPYAAPPVGELRWKAPHPVKPWSGERDAGKW
GPACWQNRDDCMAMGGGDPGELSEDCLYLNVWTPDITPSRPLPVMVWIHGGAYTIGSGGL
TPYSGAPLAQRGAIVVTLNYRLGHFGFFAHPALDKEYPQGEEINNFALLDQIAALHWVQR
NIHAFGGNAHNVTLMGESAGARSVLSLFTSPLAQGLFHKGIVQSAYTLPDVPRAAALQKG
QKLAGHFNLPAATAAQLRDLPAEAFLPLDHSLSCGPVAISGDRVLPVPMLDVFTAGRQHP
LPLIIGSNSDEASVLEFFGVDAARSIAEMRKKHPLMLQMIKWLYRGVSNDAELGRRVARD
MSFTIMGYIVSRAQQRIAVPCWRYYFDYVSENSRDIYRHGTWHGNEIPYVLNTLGQFTAE
ETGRPFTLGDEEFAERVSEYWLNFAREATPGTHAISGEIDWPACHSSTDQTLRFGCNGLA
DIAIEKRFMRHRMRVFRILMKALVQLSH
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgagaaacgatcaacgattacgtattgtgacagccgaaggcattctgcgcggcaacgag
gcagaaggtgttttcgtttttaaagggatcccctatgcggctcctcctgtcggggaactg
cgctggaaagccccacatccggtcaagccctggtccggagaaagagacgccggcaaatgg
ggaccagcctgctggcagaaccgtgacgactgtatggcaatgggcggtggtgacccgggt
gaactaagcgaagattgcctgtatctcaatgtctggacgccagatattaccccttcacgg
ccgctacccgttatggtgtggatccacggtggggcttacaccatcggttcaggggggtta
accccttatagcggcgcgcctttagcgcagcgtggtgccatcgtcgtcaccctgaattac
cgtcttgggcattttggtttctttgcccatccggcgctggacaaagaatatcctcaaggc
gaggaaatcaataactttgctttgctcgatcaaatcgccgccctgcattgggtacagcgt
aacattcacgcatttggcggtaatgcgcataacgtcactctgatgggggaatcggcaggt
gcacgcagcgtactctcactctttacatcaccgctggcacagggattatttcacaaaggg
attgtgcagagtgcttacacattacctgatgtaccccgcgccgccgcgttgcagaaaggg
caaaagttggctggccatttcaatctgccggctgctacggcagctcagttacgtgacctt
cctgccgaagcattcttgccgctggatcactccctgagttgcgggccggtggcgatctct
ggcgatcgcgtacttccggttccaatgctcgatgtgtttacggccggcaggcaacatcct
ctgccgctcatcattggcagtaacagtgacgaagccagcgtattagaattctttggcgtt
gatgcggcacggtcgattgcggaaatgcgcaaaaagcatccgctgatgctgcagatgatc
aaatggttatatcgcggcgttagcaacgatgccgaactggggcggcgggtggcgcgcgat
atgtcctttaccatcatggggtatatcgtctcacgcgcgcagcagcgcatcgccgtgccg
tgctggcgttactattttgattatgtttctgaaaattcacgtgatatttaccgtcatggc
acctggcacggtaatgaaattccctacgtgctaaatacgctcggccagttcacggcggaa
gagaccgggcgaccgtttaccctcggcgatgaagagtttgccgaacgcgtcagcgaatac
tggcttaactttgcgcgcgaagcaacgcccggtacccacgcgatcagcggtgaaattgac
tggcccgcctgtcactcttctaccgaccaaactctgcgttttggttgtaacggtctggct
gatatcgcgattgaaaaacgctttatgcgccacagaatgcgggtttttcgcattttgatg
aaagccctggtccaactgagccactaa

DBGET integrated database retrieval system