KEGG   Pectobacterium atrosepticum SCRI1043: ECA0573
Entry
ECA0573           CDS       T00186                                 
Name
(GenBank) putative plasmid-related protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG HerA_C AAA_10 DUF87 FtsK_SpoIIIE AAA_22 DUF2913 AAA_23
Other DBs
NCBI-ProteinID: CAG73488
UniProt: Q6D9P2
Position
635349..638210
AA seq 953 aa
MFSLFNKKRLSRSREIRVPDDAIGSLAEGISIQVAGRASLQRPGKMTIQDEVKLNHANPS
IIDYLPWAEFLDSDKCLLLDDGISVGAVYEVSPVATEGRTEARLEQIRDTVEDAIQDSFE
ELDENPWVVQFFCQDENNVDTYVDRLRGYVKPHAQGTPFSEAWLKETERHLRGIARSEGL
FTDTKITGQPWRGQQRRTRMVIYRWIGKNNRDPMPPIAMLNQVCERVTSALSGAGVMCVR
QNGHQVHGWLLRHFNPSPEWVDKDTLYRQAAYFDRRDTPDGTMPVLNDFTETLWFNPPRS
DVENGVWWFDNQAHCALPVEKLRRPPKPGAITGEMLRGEKINALMDLFPEGSTLCMTIVV
QPQDKLEADFTRLAKNAVGENTESGRVRQDVKTVKEYLGNRHKLYRAGLTFLLRADDVET
LNHKCVELTTVLLGAGLQPVRPEYDVAPLNTYLRALPMCFNPETDKKHWYTRLTWVQHLA
GLLPVTGRETGTGNPGISFFNRGGDVFSFDPLNKGDRSQNAHKLIFGPTGAGKSATMCAM
LSQVMAIHRPRLFIAEAGNSFGLLADYFESLGLTVNKVSIKPDSGLSLPLFGDAYQLLNS
DVPLAIDADALPELDADSEDPDDEKEDNKEKQKRDILGEMEISARMMITGGDTKEEAELK
RADRAMIREALIMAAKAAYAASEQMLPSHLQRALLNISMDTERNEQRRTKAAEMAESLSM
FTQEGSFEAELFNREGQLWPEADVTLIDLGYFAREGYEAQMALTMVSLTNTVNNIAERDQ
YKKRDIVFAIDEAHIATVNPLLAPYMTKIVKMWRKLGAWLWLATQNLEDFPDAAGKMLNM
AEWWLCLVMPKKEVDDISRFKSLTDEQKSVLMSASKLDKCYTEGVVLSKNVQALFRAVPP
SLYLALGMTEKEEKVERRRLMNEFHCSELEAAMRVATALDNARGLVEQEKAAV
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgttctcactatttaataaaaagcgcctatcccgctctcgggaaattcgtgtacctgat
gacgcaatcggcagtcttgctgaaggtatttcaattcaggttgccggacgagcatcactg
caacgtcccgggaagatgacgatccaggatgaggtaaagctcaatcatgctaatccctca
atcatcgattacctgccgtgggcagagttcttagacagtgataaatgcctgttgttggat
gatggcatttctgtcggagcggtatatgaagtctctcccgttgcgacagaaggacgtacg
gaagcgcgcctggaacaaatccgcgatacggtcgaggatgcgatacaggacagctttgaa
gaactggatgaaaacccctgggttgtgcagttcttttgtcaggatgagaacaatgtcgat
acttatgtcgatcgcctgaggggctatgtcaaaccccatgcgcagggcacaccgttctcg
gaagcctggctgaaagagaccgagcgacatttacgggggattgcccgttctgaaggactg
tttactgacaccaaaattactggccagccctggcgcggtcagcagcgtcgtacgcgcatg
gtgatataccgctggattggtaaaaacaaccgagacccgatgccgccgatcgctatgctc
aaccaggtatgtgaacgtgtgaccagtgcattgtctggtgctggggtaatgtgtgtgcga
cagaatggccatcaggtacatggctggttgctgcgtcattttaatccgtcgccggaatgg
gtggataaagacacgttatatcgtcaggcagcctattttgaccgacgcgatacacctgat
ggcaccatgccggtactcaatgattttacggaaacgctatggttcaacccgccacgttcg
gacgtggagaacggcgtatggtggtttgataatcaggcgcattgtgcgttgccggtcgag
aaattacggcgcccgccaaaacccggagcgattacaggggaaatgctccggggggagaag
atcaatgcgttaatggacctctttccggagggcagcaccctgtgtatgaccattgtggta
cagccacaagataagctggaagccgattttacccgactagcgaagaatgccgtaggggag
aacaccgagtctggccgtgttcgccaggatgtcaaaaccgtcaaagagtatctgggtaac
cggcataagctgtaccgtgctgggctgacgtttttgctgcgcgctgatgatgtggaaacg
ctcaatcataaatgcgtagagctgacgacggtgttgctaggtgctggcttgcagccagtg
cggccggagtatgacgttgcaccactgaacacctatttgcgggcattacctatgtgtttt
aacccggagacggataagaaacactggtatacacggctaacgtgggtacagcatctggca
gggttattgcctgtaacgggccgagaaaccggtacgggtaatcccgggatcagctttttc
aatcgcgggggcgacgtattttcattcgatccgttgaataaaggcgatcgcagccaaaat
gcacataagctgatatttggaccgaccggtgccgggaagtcggcaacgatgtgcgcgatg
ttatcgcaggtgatggctatccacagaccccgactgtttattgctgaagccggcaactca
tttgggttattggccgattactttgaaagtctggggctgacggtgaataaggtcagtatc
aaaccggatagtggattgagtcttccgttgtttggtgatgcttatcagttattgaacagt
gatgttcctctagccattgatgccgatgcattgcctgagttggatgcggacagcgaagat
ccagacgacgagaaagaagataataaagaaaaacaaaaacgagatattttgggggaaatg
gagatttcagcccgcatgatgattactggcggggatacgaaagaagaggctgagctgaag
cgcgccgatagggcgatgatccgtgaagccttaattatggcggctaaagctgcctatgcg
gcttcagaacaaatgctaccttctcatttgcaacgtgcattactcaatatttccatggat
accgaacgtaatgaacagcgtcggactaaagccgcagagatggccgaatcgttaagcatg
ttcacacaagaggggagttttgaagcggaactatttaaccgtgaggggcagctctggcca
gaagctgatgtgacgctgattgacctgggctattttgcgcgtgaagggtatgaagcgcag
atggcgctgacgatggtgtcactgactaacaccgttaacaatattgctgaacgcgaccag
tacaagaagcgagacatcgtatttgccatcgatgaggcacacattgcaaccgtgaatccg
cttctggcgccatatatgaccaagatcgtcaaaatgtggcgaaaactgggtgcctggctc
tggctggcaacgcagaacctggaggatttccctgacgctgccggcaaaatgcttaacatg
gctgaatggtggctatgtttggttatgccgaagaaagaggtcgatgatatcagccgcttc
aagtccctgaccgatgaacagaaatcggtgttgatgtcggccagcaagctggataaatgc
tacaccgagggcgtcgtattatcgaagaacgtccaggcattgttccgtgccgttcccccc
agtttgtatttggcgctcggtatgacagaaaaagaagaaaaagtggaacgacgtcgtttg
atgaatgaattccattgttcggagctggaagcggcaatgcgggtcgccacagcattagat
aacgcccgtggtttggttgagcaggagaaagctgcagtatga

DBGET integrated database retrieval system