KEGG   Equus caballus (horse): 100058358
Entry
100058358         CDS       T01058                                 
Name
(RefSeq) actin-related protein 2/3 complex subunit 4 isoform X14
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
ecb  Equus caballus (horse)
Pathway
ecb04144  Endocytosis
ecb04530  Tight junction
ecb04666  Fc gamma R-mediated phagocytosis
ecb04810  Regulation of actin cytoskeleton
ecb05100  Bacterial invasion of epithelial cells
ecb05132  Salmonella infection
ecb05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100058358
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100058358
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100058358
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100058358
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100058358
   05135 Yersinia infection
    100058358
   05100 Bacterial invasion of epithelial cells
    100058358
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100058358
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ecb04812]
    100058358
Membrane trafficking [BR:ecb04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100058358
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100058358
SSDB
Motif
Pfam: ARPC4 Sm_like Cmr7A
Other DBs
NCBI-GeneID: 100058358
NCBI-ProteinID: XP_014586907
Ensembl: ENSECAG00000012891
Position
16:complement(8463587..8497254)
AA seq 168 aa
MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEK
VLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITN
FHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
NT seq 507 nt   +upstreamnt  +downstreamnt
atgactgccactctccgcccctacctgagtgccgtgcgggccacactgcaggctgccctc
tgcctggagaatttctcctcccaggtcgtggaacgacacaacaagccggaggtggaagtc
aggagtagcaaagagctcctgttacaacccgtgaccatcagcaggaatgagaaggaaaaa
gttctgattgagggctccatcaactctgtccgggtcagcattgctgtgaaacaggctgat
gagattgagaagattttatgccacaagttcatgcgtttcatgatgatgcgagcagagaac
ttctttatccttcgaaggaaaccagtggaggggtatgacatcagttttctgatcaccaac
ttccacacagagcagatgtacaaacacaagttggtggactttgtgatccactttatggag
gagatcgataaggagatcagtgagatgaagctgtcagtcaatgcccgtgcgcgcatcgtg
gctgaggagttcctcaagaatttttaa

DBGET integrated database retrieval system