KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c3392Help
Entry
c3392             CDS       T00106                                 

Definition
(GenBank) ClpB protein
  KO
K11907  type VI secretion system protein VasG
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    c3392
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecc02044]
    c3392
Secretion system [BR:ecc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   c3392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 AAA_22 AAA_25 Clp_N ATPase_2 AAA_24 Sigma54_activat AAA_7 IstB_IS21 NACHT Zeta_toxin AAA_14 AAA_29 RsgA_GTPase T2SSE AAA_6 DUF815 CxC7
Motif
Other DBs
NCBI-ProteinID: AAN81837
UniProt: A0A0H2VA60
Position
3229545..3232181
Genome map
AA seq 878 aa AA seqDB search
MTGNHPAALLRRLNPYCARALDAAASLCQTRAHAEITIEHWLLKLLEQGEGDITVIARRY
EWDIDTLWQSLLAHLDTLPRPVRERPQLSEPLAALIRQAWLIASLEGDDPQIRSQHLLMA
LTEKPMLPACNDLWVLLSLSRVQLERLRPLLDAQSDECPARQPQVTEPLTSALPETATAD
APAKTLTEKQDDALLAVLNRFTEDVTEKARSGRIDPVFGRDTEIRQMVDILSRRRKNNPI
LVGEPGVGKTALVEGLALRITEGNVPDSLKTVHIRTLDLGLLQAGAGVKGEFEQRLKNVI
DAVQKSPEPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQYF
ERDAALERRFQMVKVDEPDDDTACLMLRGLKARYAQHHGVHMLDSAIQTAVRLSRRYLTG
RQLPDKAVDLLDTAGARVRMSLDTLPEPLTQLHVRLAALDIEREAIEQDSVFYPEASPER
LAELTDLRDELQAEAGHLEAQYQQEKALAQQIMTLRQEGTDSTELQQQLRTHQGFAPLLA
LDVDARAVATVVADWTGIPLSSLLKDEQSDLLSMEQSLENRVVGQSPALCAIAQRLRAAK
TGLTPENGPQGVFLLTGPSGTGKTETALTLADTLFGGEKSLITINLSEYQEPHTVSQLKG
SPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDVMNLFYQVFDRGFMRDGEGREID
FRNTVILMTANLGSDHIMQLLEEKPDATDADLHELLYPLLREHFQPALMARFQTVIYRPL
GQEAMRAIVEMKLAQVARRLHQHYGLETEISNSLYDALTAACLLPDTGARNIDSLLNQQI
LPVLSQQLLAQQAVHHKPARLRLDWDDEDGIVLEFDEK
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaaatcaccccgccgcgctgctgcgtcgccttaacccatactgtgcacgggcg
ctggacgctgccgcctcactgtgtcagacccgcgcccatgcggaaataaccattgaacac
tggctgctgaaactgctggagcagggagaaggcgatatcacggtgattgcccgccgctat
gaatgggatatcgacacgctctggcagtctctgctggcacatctggacaccttaccccgc
ccggtccgcgaacgtcctcaactttctgaaccgctggcagcgcttatccgacaggcgtgg
ctgatagcgtcactggaaggcgacgatccacaaatccgcagccagcatctgctgatggcg
ctgacagaaaaaccgatgctgcccgcctgtaatgacctgtgggtattgctgagtctgagc
cgcgtgcagcttgagcggctgcgtcccctgctggatgcgcagtcggatgaatgtccggca
cgtcagccacaggtcaccgaaccgctgacctctgcactgccggagacggcaacggcggac
gcaccggcaaaaacgctgacggagaaacaggatgacgccctgctggcggtgcttaaccgc
tttaccgaagacgtgacggaaaaagcccgcagcgggcgaatcgacccggtattcgggcgc
gacacggaaattcgccagatggtcgatatcctctcccgtcgccgcaaaaacaacccgatt
ctggtgggagaaccgggggtgggcaaaaccgcgctggtggaagggctggcgctgcgtatc
accgaaggcaacgtgccggacagcctgaaaacggtgcatatccgcacactggacctcggt
ctgttacaggctggcgcgggcgttaaaggtgaatttgaacagcggctgaaaaatgtcatc
gatgcagtgcagaaatcaccggagccggtactgctgtttattgatgaagcccataccatt
atcggtgcgggtaatcaggcaggcggcgcggatgcggcgaacctgctgaaaccggcactg
gcaaggggcgaactgcgcaccatcgcggcgaccacgtggagcgaatacaaacagtatttt
gagcgcgacgccgcgctggagcgccgcttccagatggttaaggttgacgagccggatgat
gacaccgcctgcctgatgctcagggggctgaaagcccgctatgcgcagcaccacggcgta
catatgctggacagcgccattcagaccgccgtgcgcctgtcgcgccgctatctgaccgga
cgccagttgccggacaaggcggttgatttgctggataccgccggggcaagagtccgcatg
agccttgacaccctgccggaaccgttgacgcagcttcatgtgcgactggcggcactggat
attgagcgggaagcgattgagcaggacagcgtattttatcccgaagccagcccggagcgg
ctggcggaactgaccgatttgcgtgatgagctacaggcagaagccgggcatctggaagcg
cagtatcagcaggaaaaggcactggcgcagcagattatgacgttgcgtcaggaagggaca
gacagcactgaactgcaacagcaactgcgaacgcatcagggctttgcaccgctgctggcg
ctggatgtggacgcccgcgccgtcgccacggtggtggcggactggaccggcatcccgcta
tcttccctgctcaaggacgagcagagcgacctgctcagtatggaacagagtcttgaaaac
cgcgttgtcgggcaaagcccggcgctctgcgccatcgcacagcggctgcgggcggctaag
accggcctcacgccggagaacggcccgcagggggtattcctgctgaccggccccagcggc
accggtaaaaccgaaactgcgctcacactggccgacactctgtttggcggtgaaaaatcc
cttatcaccatcaacctctccgaatatcaggagccgcataccgtctcccagcttaagggg
tctcctccgggctacgttggctacggtcagggtggcgtactcaccgaagccgttcgcaaa
cgcccttacagcgtggtgctgctcgacgaagtggaaaaggcgcaccgcgacgtaatgaac
ctgttctatcaggtatttgaccggggctttatgcgcgacggcgaaggccgggaaattgac
ttccgcaacaccgtgattctgatgacggctaatctgggcagcgaccacatcatgcaactg
ctggaggaaaaaccggacgccacggacgcagacctgcatgaactgctgtatcccctgctg
cgcgagcacttccagccagcactgatggcgcgttttcagacggtgatttaccgcccgctg
ggacaggaggcgatgcgcgccattgtggaaatgaaactggcgcaggtggcccgccgtctt
caccagcactatgggctggaaacggaaatcagtaacagcctgtacgacgccctgaccgcc
gcctgcctgctgccggacaccggtgcgcgtaatatcgacagcctgctgaaccagcaaatc
ctgccggtcttaagccagcagttgctggcgcagcaggccgtgcatcataagcctgcccga
ctgcggcttgactgggatgatgaagacgggattgtgctggaatttgatgagaaataa

DBGET integrated database retrieval system