KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z5617Help
Entry
Z5617             CDS       T00044                                 

Definition
(GenBank) putative sorbose PTS component
  KO
K02812  sorbose PTS system EIIA component [EC:2.7.1.206]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00051  Fructose and mannose metabolism
ece01100  Metabolic pathways
ece02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ece00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Z5617
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Z5617
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ece02000]
    Z5617
Enzymes [BR:ece01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     Z5617
Transporters [BR:ece02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    Z5617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man STb_secrete HTH_DeoR
Motif
Other DBs
NCBI-ProteinID: AAG59218
UniProt: A0A4Q2TNY8
Position
complement(5111144..5111551)
Genome map
AA seq 135 aa AA seqDB search
MVNAIFCAHGKLACAMLESVQMVYGNANVEAVEFVPGENAGDIVAKLEKLVSIHNQNEWL
IAVDLQCGSPWNAAAMLAMRNPRLRVISGLSLPLALELVDNQDSMNVDELCEHLTQIAKQ
TCVVWKQLATTEEDF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacgccattttttgtgcccacggcaaattagcttgcgccatgctggaatcggtt
cagatggtttacggcaacgccaatgttgaagccgttgaatttgtgcccggtgaaaacgcc
ggagacatcgtagcaaagctggaaaaattagtaagcattcacaatcaaaatgagtggctg
attgccgtggatttacagtgcggcagcccgtggaatgcggcagcgatgcttgcgatgcgc
aatcctcgtctgcgggtaatcagcggactttctctgccgctggcgctcgaactggttgat
aaccaggacagcatgaatgttgatgaactgtgtgaacacctgacgcaaatcgcaaagcaa
acctgcgttgtctggaaacaactggcaacgacagaggaggatttctga

DBGET integrated database retrieval system