KEGG   Escherichia coli K-12 W3110: JW0932
Entry
JW0932            CDS       T00068                                 

Gene name
uup
Definition
(GenBank) fused predicted transporter subunits and ATP-binding components of ABC superfamily
  KO
K15738  ABC transport system ATP-binding/permease protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0932 (uup)
Transporters [BR:ecj02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Other ABC transporters
    JW0932 (uup)
SSDB
Motif
Pfam: ABC_tran ABC_tran_CTD AAA_21 ABC_tran_Xtn SMC_N AAA_22 AAA_15 AAA_29 AAA_16 RsgA_GTPase AAA_33 AAA_23 AAA_30 TsaE AAA_18 MMR_HSR1 AAA RNA_helicase AAA_24 AAA_28 NACHT ATP-synt_ab AAA_25 AAA_14 PduV-EutP AAA_7 AAA_5 Rad17 ATPase_2 MobB NB-ARC AAA_13 Dynamin_N T2SSE UPF0242 DUF948 Ploopntkinase3 FapA AAA_19
Other DBs
NCBI-ProteinID: BAA35707
UniProt: P43672
Structure
PDB: 
2LW1

Position
1010386..1012293
AA seq 635 aa
MSLISMHGAWLSFSDAPLLDNAELHIEDNERVCLVGRNGAGKSTLMKILNREQGLDDGRI
IYEQDLIVARLQQDPPRNVEGSVYDFVAEGIEEQAEYLKRYHDISRLVMNDPSEKNLNEL
AKVQEQLDHHNLWQLENRINEVLAQLGLDPNVALSSLSGGWLRKAALGRALVSNPRVLLL
DEPTNHLDIETIDWLEGFLKTFNGTIIFISHDRSFIRNMATRIVDLDRGKLVTYPGNYDQ
YLLEKEEALRVEELQNAEFDRKLAQEEVWIRQGIKARRTRNEGRVRALKAMRRERGERRE
VMGTAKMQVEEASRSGKIVFEMEDVCYQVNGKQLVKDFSAQVLRGDKIALIGPNGCGKTT
LLKLMLGQLQADSGRIHVGTKLEVAYFDQHRAELDPDKTVMDNLAEGKQEVMVNGKPRHV
LGYLQDFLFHPKRAMTPVRALSGGERNRLLLARLFLKPSNLLILDEPTNDLDVETLELLE
ELIDSYQGTVLLVSHDRQFVDNTVTECWIFEGGGKIGRYVGGYHDARGQQEQYVALKQPA
VKKTEEAAAAKAETVKRSSSKLSYKLQRELEQLPQLLEDLEAKLEALQTQVADASFFSQP
HEQTQKVLADMAAAEQELEQAFERWEYLEALKNGG
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgtcattaatcagtatgcatggcgcatggctgtcgttcagcgacgcgccgcttctcgat
aacgcagaactgcatatcgaagataacgaacgtgtttgtctggtgggccgcaacggcgca
ggcaaatcgacgttaatgaaaatcctcaaccgtgaacaagggctggatgacggtcgcatt
atttacgagcaagatttgattgtagcgcgtctgcaacaggatccgccgcgtaacgttgag
ggtagcgtttatgatttcgttgccgaaggcattgaagaacaagcggaatatctgaaacgc
tatcacgatatttcgcgcctggtgatgaacgacccgagcgagaaaaatctcaacgaactg
gcgaaggttcaggaacagctggatcaccacaacctgtggcagctggaaaaccgcatcaac
gaagtgctggcgcaactggggttagatcctaacgttgcgctgtcgtcgctttccggcggc
tggttgcgtaaagcggcattaggacgcgcgctggtgagtaatccgcgcgtgctgttgctt
gatgaaccgacaaaccacctggatattgaaaccatcgactggctggaagggtttttgaaa
actttcaacgggacgattattttcatctcccacgaccgttcgtttatccgcaatatggcg
acgcgcattgttgatctcgatcgcggcaagctggtgacctatccagggaattacgaccag
tacctgctggaaaaagaagaagccctgcgcgtggaagaattacaaaatgccgagttcgat
cgcaaactggcgcaggaagaggtgtggatccgccaggggatcaaagcacgccgtacccgt
aatgaaggccgcgtacgcgccctgaaagcgatgcgtcgcgaacgtggtgaacgtcgcgaa
gtgatgggtaccgcaaagatgcaggtggaagaggccagccgctccggtaaaatcgttttc
gaaatggaagacgtttgctaccaggttaacggtaagcaactggtgaaagatttttctgcc
caggttctacgtggcgacaaaattgccctgattggtccgaatgggtgcggcaaaaccacg
ctgctaaaactgatgctcggtcagcttcaagcggacagcgggcgtattcacgttggcacc
aaactggaagtggcttatttcgatcagcaccgcgcggaactggatcccgataaaacggtg
atggataaccttgccgaaggtaagcaagaggtgatggttaacggcaagccacgccacgta
ttgggctatttgcaggactttctgttccatccgaaacgggcgatgacgccggtacgtgcg
ctttctggcggtgagcggaaccgcttgctgctggcgcgtttgttcctcaaaccaagcaac
ttattgattcttgacgaaccgaccaacgatcttgatgtcgaaacgctggaactgctggaa
gaactgatcgacagctatcagggcacggtattgctggttagccacgatcgtcagtttgtc
gataacaccgttacagaatgttggatcttcgaaggcggcggtaaaattggtcgttatgtc
ggcggttatcatgatgcccgtggtcagcaagagcagtatgtggcgctcaaacagcctgcg
gtgaaaaaaaccgaagaagccgccgcggcaaaagcagaaactgtaaaacgcagcagtagc
aaactaagctataaattgcagcgcgaactggagcagctaccgcaattgctcgaagatctg
gaggcgaagctggaagccctacagacgcaagtggcggatgcttccttcttcagtcagccg
catgagcagacgcaaaaagtgcttgctgatatggctgctgcagagcaggagctggagcaa
gcctttgaacgctgggagtatcttgaagcgttaaaaaatggtggctga

DBGET integrated database retrieval system