KEGG   Escherichia coli K-12 W3110: JW2007
Entry
JW2007            CDS       T00068                                 

Gene name
hisF
Definition
(GenBank) imidazole glycerol phosphate synthase, catalytic subunit with HisF
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00340  Histidine metabolism
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01230  Biosynthesis of amino acids
Module
ecj_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    JW2007 (hisF)
Enzymes [BR:ecj01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     JW2007 (hisF)
SSDB
Motif
Pfam: His_biosynth Dus NMO ThiG TMP-TENI FMN_dh G3P_antiterm Oxidored_FMN IMPDH
Other DBs
NCBI-ProteinID: BAA15857
UniProt: P60664
Position
2097981..2098757
AA seq 258 aa
MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRV
VDKSWVSRVAEVIDIPFCVAGGIKSLEDAAKILSFGADKISINSPALADPTLITRLADRF
GVQCIVVGIDTWYDAETGKYHVNQYTGDESRTRVTQWETLDWVQEVQKRGAGEIVLNMMN
QDGVRNGYDLEQLKKVREVCHVPLIASGGAGTMEHFLEAFRDADVDGALAASVFHKQIIN
IGELKAYLATQGVEIRIC
NT seq 777 nt   +upstreamnt  +downstreamnt
atgctggcaaaacgcataatcccatgtctcgacgttcgtgatggtcaggtggtgaaaggc
gtacagtttcgcaaccatgaaatcattggcgatatcgtgccgctggcaaaacgctacgct
gaagaaggcgctgacgaactggtgttctacgatatcaccgcttccagcgatggccgtgtg
gtagataaaagctgggtatctcgcgtggcggaagtgatcgacattccgttttgtgtggcg
ggtgggattaagtctctggaagatgccgcgaaaattctttcctttggcgcggataaaatt
tccatcaactctcctgcgctggcagacccaacattaattactcgcctggccgatcgcttt
ggcgtgcagtgtattgtggtcggtattgatacctggtacgacgccgaaaccggtaaatat
catgtgaatcaatataccggcgatgaaagccgcacccgcgtcactcaatgggaaacgctc
gactgggtacaggaagtgcaaaaacgcggtgccggagaaatcgtcctcaatatgatgaat
caggacggcgtgcgtaacggttacgacctcgaacaactgaaaaaagtgcgtgaagtttgc
cacgtcccgctgattgcctccggtggcgcgggcaccatggaacacttcctcgaagccttc
cgcgatgccgacgttgacggcgcgctggcagcttccgtattccacaaacaaataatcaat
attggtgaattaaaagcgtacctggcaacacagggcgtggagatcaggatatgttaa

DBGET integrated database retrieval system